DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11523 and Gskip

Sequence 1:NP_649386.1 Gene:CG11523 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001014220.2 Gene:Gskip RGDID:1308470 Length:144 Species:Rattus norvegicus

Alignment Length:116 Identity:36/117 (31%)
Similarity:58/117 (50%) Gaps:16/117 (14%)


  Fly    21 EANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQYDTIDEDSR 85
            ||.|::|||...|..:.:|..|.......|:|:.|.|....|::::..|.::|...:|.::    
  Rat    41 EAEAVVNDVLFAVNNMFVSKSLPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQVE---- 101

  Fly    86 ISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQQ 136
                        |..:....||.|:|||.:||.|.|:|||.|.|:|.||::
  Rat   102 ------------DHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKR 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 35/113 (31%)
GskipNP_001014220.2 DUF727 38..138 CDD:283065 35/113 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187303925
eggNOG 1 0.900 E1_KOG3965
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1508955at2759
OrthoFinder 1 1.000 FOG0003052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12490
Phylome 1 0.910 0.622 Consistency score
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.