DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11523 and Y43F8B.2

Sequence 1:NP_649386.1 Gene:CG11523 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_507796.1 Gene:Y43F8B.2 WormBaseID:WBGene00012813 Length:317 Species:Caenorhabditis elegans

Alignment Length:143 Identity:41/144 (28%)
Similarity:69/144 (48%) Gaps:26/144 (18%)


  Fly     8 ADPGEEQAFNCEDEANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKI 72
            |..|.|.:.  |.||.|.::::...|..|.:|..|......|::|:.|:|:...|::::.:|::|
 Worm   148 ASRGGESSL--ELEAIAAVHELSFAVQSISVSEMLPRTPDLIFVNVTTLEAQPYCLELTLKGWRI 210

  Fly    73 VSSQYDTIDEDSRISALLRNGQEQGDDEEEEIF----ETPYALLDKISPRYVESFGNQLCQQLRA 133
            .|               ||:....||....|:|    ::.|.|:|.|||.|.|.|..:|.|:|:.
 Worm   211 TS---------------LRSDCMVGDFTRLELFTKYYDSLYLLMDDISPGYRERFSEKLVQRLKL 260

  Fly   134 LQQMRTEFNEEDE 146
            :     |..|||:
 Worm   261 I-----EAGEEDQ 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 34/120 (28%)
Y43F8B.2NP_507796.1 DUF727 156..259 CDD:283065 34/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187299347
eggNOG 1 0.900 E1_KOG3965
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1508955at2759
OrthoFinder 1 1.000 FOG0003052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133163
Panther 1 1.100 LDO PTHR12490
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3011
TreeFam 1 0.960
87.830

Return to query results.
Submit another query.