DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11523 and C06A12.3

Sequence 1:NP_649386.1 Gene:CG11523 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001255953.1 Gene:C06A12.3 WormBaseID:WBGene00007357 Length:253 Species:Caenorhabditis elegans

Alignment Length:135 Identity:33/136 (24%)
Similarity:65/136 (48%) Gaps:19/136 (14%)


  Fly    10 PGEEQAFNCEDEANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVS 74
            |.::.....|.||.|.::::...|.:|.:|..|...:..|::|::|.|.:...::::.:|::|.|
 Worm   134 PSDDDVGPLELEAIAAVHELAHEVQDISVSEMLPRTSDLIFVNVKTQEGSPYTLELTMKGWRIAS 198

  Fly    75 SQYDTIDED-SRIS---ALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQ 135
            |..|.::.| ::||   ...||.:|               ||..|||.:...|...:.|:|..|.
 Worm   199 SHTDCMNGDYTKISLHTKYYRNARE---------------LLKFISPDHATRFNECVAQKLSKLA 248

  Fly   136 QMRTE 140
            ::..:
 Worm   249 EVAVQ 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 31/120 (26%)
C06A12.3NP_001255953.1 DUF727 142..247 CDD:283065 31/120 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187299374
eggNOG 1 0.900 E1_KOG3965
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I3991
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1508955at2759
OrthoFinder 1 1.000 FOG0003052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12490
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.950

Return to query results.
Submit another query.