DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11523 and T24H7.3

Sequence 1:NP_649386.1 Gene:CG11523 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_495248.1 Gene:T24H7.3 WormBaseID:WBGene00020782 Length:156 Species:Caenorhabditis elegans

Alignment Length:125 Identity:34/126 (27%)
Similarity:69/126 (55%) Gaps:11/126 (9%)


  Fly    19 EDEANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQYDTIDED 83
            |:||.|.:.:....|..|.:|..|...:..:::|:.|.|:.|.|::::.:|:::.|::.|.:   
 Worm    43 EEEAMAAVRENAFAVNLIGVSEMLPRTSQLLFINVTTFENHTHCIELTQKGWRVASNRNDCM--- 104

  Fly    84 SRISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQQMRTEFNE 143
                    ||..:..|...:.||:.:.||..|||.:.|:||::|..:|..|::.|::.:|
 Worm   105 --------NGDFRQLDIHTKYFESLHTLLMDISPLFRETFGSKLISKLSELKKERSDSDE 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 31/115 (27%)
T24H7.3NP_495248.1 DUF727 42..147 CDD:283065 31/115 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187299362
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I3991
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1508955at2759
OrthoFinder 1 1.000 FOG0003052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133163
Panther 1 1.100 O PTHR12490
Phylome 1 0.910 0.706 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3011
TreeFam 00.000 Not matched by this tool.
109.940

Return to query results.
Submit another query.