DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11523 and gskip

Sequence 1:NP_649386.1 Gene:CG11523 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001096457.1 Gene:gskip XenbaseID:XB-GENE-987914 Length:139 Species:Xenopus tropicalis

Alignment Length:116 Identity:35/117 (30%)
Similarity:55/117 (47%) Gaps:16/117 (14%)


  Fly    21 EANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQYDTIDEDSR 85
            ||.||:|||...|..:.:|..|.......|:|:...|....|::::..|.::....:|.:.|...
 Frog    36 EAEAIVNDVLFAVGNMFVSKTLPCAVDVAYINVEIKEGTRYCLELTDAGLRVAGYAFDHLAEGLC 100

  Fly    86 ISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQQ 136
                            .:..||.|:|||.:||.|.|:|||.|.|:|.||::
 Frog   101 ----------------SQYHETVYSLLDSLSPAYREAFGNALLQRLEALKR 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 34/113 (30%)
gskipNP_001096457.1 DUF727 35..133 CDD:310132 34/113 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187304213
eggNOG 1 0.900 E1_KOG3965
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1508955at2759
OrthoFinder 1 1.000 FOG0003052
OrthoInspector 1 1.000 T1060621
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3011
TreeFam 1 0.960
98.840

Return to query results.
Submit another query.