DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and Moxd1

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_067484.2 Gene:Moxd1 MGIID:1921582 Length:613 Species:Mus musculus

Alignment Length:652 Identity:200/653 (31%)
Similarity:312/653 (48%) Gaps:114/653 (17%)


  Fly   101 AAASGTP--IWDHAIDLNDD--FRILWQIINQDITFEIQARTLGYVGFGFSPDGNLAGADMAIGW 161
            |.|:|:|  .:.|.:.|:.:  :.:.|....:.:.|.::.||.|||||||||.|::|.||:.:|.
Mouse    15 ATAAGSPGRSYPHRVVLDPEGKYWLHWGRQGERLAFRLEVRTNGYVGFGFSPTGSMAAADIVVGG 79

  Fly   162 VDKGQTYFQDRHVTRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTM 226
            |..|:.|.||...  |.|.|...|..|||.|....||:||||:.|.|:|.||| .:|.::|:.|:
Mouse    80 VAHGRPYLQDYFT--NADRELEKDAQQDYHLDYAMENSTHTVIEFSRELHTCD-VNDKSLTDSTV 141

  Fly   227 RLLYMYHAQDPPHGSVRPGTLPDPARAFRPYRPMVLMQRAQLPMPSPTHDERVRVL-------EL 284
            |:::.||..||.....:...|....|:.|...|                 |:..|:       :|
Mouse   142 RVIWAYHHDDPGESGPKYHDLNRGTRSLRLLNP-----------------EKANVVSTVLPYFDL 189

  Fly   285 RNEDVELPAGDLPLFWCKMFKLEDINRKHHLIRYEPIYDSSSSVHYLQHITLHECQGAHAELEEM 349
            .|::|.:| .....:||:|||:.....|||:|:.|||.:.... :.:.||.:::|.   :...:.
Mouse   190 VNQNVPIP-NKGTTYWCQMFKIPTFQEKHHVIKVEPIIERGHE-NLVHHILVYQCS---SNFNDS 249

  Fly   350 AREQGRPCLGARSIP---LACNAIVASWSRGSEGFTYPHEA----GYPIESRQAKYYLMETHYNN 407
            ..:.|..|... ::|   |.|..::.:|..|.||||||...    |.|::.|   |.|:|.||:|
Mouse   250 VLDFGHECYHP-NMPDAFLTCETVILAWGIGGEGFTYPPHVGLSLGMPLDPR---YVLLEVHYDN 310

  Fly   408 LKPDFAQLHARQMADNSGLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEG----QCI 468
                  ....:.:.|:|||:::.|..:|..|||.:..|:..:..|.||||.....|||    :|:
Mouse   311 ------PARRKGLIDSSGLRVFHTTDIRRYDAGVIEAGLWVSLFHTIPPGMPEFHSEGHCTLECL 369

  Fly   469 EDCTGYAFPQQGINIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHS 533
            |:..|...| .||::|||::..|..||.::||..|:.||:..:|:|.:.|..:|:|:.|.:....
Mouse   370 EEALGAEKP-SGIHVFAVLLHAHLAGKGIRLRHFRKGEEMKLLAYDDDYDFNFQEFQYLREEQTI 433

  Fly   534 MPGDRLIAECIYDSSSRKAITLGGLTMKEESCTVLTLYYPRQKKLTTCHSLPSLPTVLHSLGIEQ 598
            :|||.||.||.|::..|..:|.|||:.:.|.|....||||| ..||.|.|:|.:...|..:|:::
Mouse   434 LPGDNLITECRYNTKDRAVMTWGGLSTRNEMCLSYLLYYPR-VNLTRCSSIPDIMEQLQFIGVKE 497

  Fly   599 L--ATDSNPVLISSPPELAGMTLEARLISYDWENQFGEFQEATRKGSFKPICWGAKNHVVPGSEF 661
            :  ...:.|.:|.||.:...::                |.:|..|  ||   |..|         
Mouse   498 IYRPVTTWPFIIKSPKQYRNLS----------------FMDAMNK--FK---WTKK--------- 532

  Fly   662 LEGYSIN-VTKTYKKHRRCKP------------------KRPL-APP--TERTAPPPASDLSELP 704
             ||.|.| :..:...:.||..                  |||. |.|  .|:.|.||...:..|.
Mouse   533 -EGLSFNKLVLSLPVNVRCSKTDNAEWSIQGMTAIPPDIKRPYEAEPLVCEKAASPPLHGIFSLR 596

  Fly   705 VL 706
            :|
Mouse   597 LL 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 53/134 (40%)
Cu2_monooxygen 282..407 CDD:279429 40/139 (29%)
Cu2_monoox_C 438..583 CDD:281675 58/149 (39%)
Moxd1NP_067484.2 DOMON_DOH 31..165 CDD:187689 53/137 (39%)
Cu2_monooxygen 186..314 CDD:279429 41/143 (29%)
Cu2_monoox_C 335..487 CDD:281675 60/154 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24407919
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H22904
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5865
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 1 1.000 FOG0005662
OrthoInspector 1 1.000 T1082982
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10157
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4667
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.