DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and moxd1

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_005160648.1 Gene:moxd1 ZFINID:ZDB-GENE-030131-9320 Length:614 Species:Danio rerio

Alignment Length:587 Identity:186/588 (32%)
Similarity:285/588 (48%) Gaps:85/588 (14%)


  Fly   112 AIDLNDDFRILWQIINQDITFEIQARTLGYVGFGFSPDGNLAGADMAIGWVDKGQTYFQD----- 171
            |:|....:.|.|......|||||:..|.||||||.||.|.::.:|:.||.|..|..|..|     
Zfish    32 ALDAERRYNIKWGFDESTITFEIEVETRGYVGFGLSPTGAMSSSDIVIGGVLNGSPYLLDYFTDS 96

  Fly   172 -RHVTRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTMRLLYMYHAQ 235
             |.|.|        ||.|:|.|:.|.||.|||||.|.|.|.||| .:|..||..|:|:::.:||:
Zfish    97 NRKVHR--------DPLQNYELLYGRENDTHTVLAFSRNLQTCD-DNDKIITGSTVRVIWAFHAE 152

  Fly   236 DPP------HGSVR---------PGTLPDPARAFRPYRPMVLMQRAQLPMPSPTHDERVRVLELR 285
            |..      ||..|         |||.|.                    :|:.|     ...:|:
Zfish   153 DVGESGLVYHGMNRG
RKSLRLLNPGTGPS--------------------IPAGT-----AFFDLQ 192

  Fly   286 NEDVELPAGDLPLFWCKMFKLEDINRKHHLIRYEPIYDSSSSVHYLQHITLHECQGAHAELEEMA 350
            |::|.:|..| ..:||::|:..::.:|||:||.||:...... :.:.||.|::|.   :.|.:..
Zfish   193 NKEVPVPHKD-TTYWCQIFRFPEMKKKHHVIRIEPLIQKGHE-NLVHHILLYQCD---SNLNKSE 252

  Fly   351 REQGRPCLGARSIP---LACNAIVASWSRGSEGFTYPHEAGYPI-ESRQAKYYLMETHYNNLKPD 411
            ..:|..|... ::|   |.|..::.:|:.|.||||||...|..| .|....|..:|.|::|  |.
Zfish   253 VNRGHECYHP-NMPDSFLTCETVLFAWAIGGEGFTYPPHVGMSIGTSIDPVYVQLEIHFDN--PS 314

  Fly   412 FAQLHARQMADNSGLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQCIEDCTGYAF 476
            .    ...:.|:|||::|::..||..|||.:..|:..:..|::|||....::||.|.::|...:.
Zfish   315 L----QGGIVDSSGLRLYYSPSLRRYDAGVIETGVWVSLYHMLPPGMTDYITEGHCTQECLQESL 375

  Fly   477 PQQ---GINIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDR 538
            ..:   |:::|||::..|..|:.:..|..||..||.|:|.|...|..:|:|:.|.|....:|||.
Zfish   376 DSEMPSGVHVFAVLLHAHLAGRAITARHFRQQLELQPLASDDQFDFNFQEFQPLSQERLILPGDS 440

  Fly   539 LIAECIYDSSSRKAITLGGLTMKEESCTVLTLYYPRQKKLTTCHSLPSLPTVLHSLGIEQL--AT 601
            ||.||.|::..|..:|.|||:.:||.|....||||| ..|..|.|||.:...|..:|:.::  ..
Zfish   441 LITECRYNTKGRMNMTWGGLSTREEMCLSFLLYYPR-VNLAKCESLPEIAGQLKFIGVTEIQEPV 504

  Fly   602 DSNPVLISSPPELAGMTLEARLISYDWENQFGE-FQEATRKGSFKPIC-------WGAKNHVVPG 658
            .:.|.:|.||.:.:.::....:..|.|..:.|: |.:..||......|       |..:..:|..
Zfish   505 TTWPFVIKSPKKYSNLSFTEAMDKYKWTMKKGKSFNDIVRKLPMNVRCSKTGQDEWSIQGMIVSP 569

  Fly   659 SE 660
            .|
Zfish   570 PE 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 58/143 (41%)
Cu2_monooxygen 282..407 CDD:279429 39/129 (30%)
Cu2_monoox_C 438..583 CDD:281675 54/148 (36%)
moxd1XP_005160648.1 DOMON_DOH 31..167 CDD:187689 59/144 (41%)
Cu2_monooxygen 188..316 CDD:279429 41/140 (29%)
Cu2_monoox_C 337..484 CDD:281675 54/148 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24402770
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H22904
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 1 1.000 FOG0005662
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10157
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4667
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.