DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and moxd1l

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001121997.1 Gene:moxd1l ZFINID:ZDB-GENE-060126-3 Length:564 Species:Danio rerio

Alignment Length:545 Identity:156/546 (29%)
Similarity:252/546 (46%) Gaps:71/546 (13%)


  Fly   107 PIWDHAIDLNDDFRILWQI--INQDITFEIQARTLGYVGFGFSPDGNLAGADMAIGWVDKGQTYF 169
            |..:| :||..:.::.|..  |...|.|::...|.|::.||.||:|.:.|||:.||.||...|||
Zfish    25 PFSEH-LDLEHNVQLKWGFDKIQGTILFQLSVNTSGWISFGLSPNGGMTGADIVIGGVDNKGTYF 88

  Fly   170 QDRHVTRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTMRLLYMY-H 233
            .|||..  |:..||||..|:|.|:...|:...||::|:|.:::|| .:|:.:|...|:|:|.| .
Zfish    89 TDRHAL--GNSMPVVDQKQNYKLLSLSESDGKTVMKFQRSIESCD-ENDLPVTILPMKLIYAYGE 150

  Fly   234 AQDPPHGSVRPGTLPDPARAFRPYRPMVLMQRAQLPMPSPTHDERVRVLELRNEDVELPAGDLPL 298
            ..|..:...:.||        :....:..|.||.|        ......::..|:..|||.. ..
Zfish   151 TDDISYHKAQRGT--------KEVNLLKYMPRASL--------SNATYFDITMENFMLPANQ-TY 198

  Fly   299 FWCKMFKLEDINRKHHLIRYEPIYDSSSSVHYLQHITLHECQGAHAELEEMAREQGRPCLGARSI 363
            :.||..:....:.|.|:.|.||:..:...||   |:.|:.|.....|..|:      .|..... 
Zfish   199 YHCKTARAPTFDSKQHIYRIEPVITNYDLVH---HLLLYRCPPTVTEPLEL------ECYTKTE- 253

  Fly   364 PLACNAIVASWSRGSEGFTYPHEAGYPIESRQAK-YYLMETHYNNLKPDFAQLHARQMADNSGLK 427
              .|...:|.|..|...|.:|..||.||...... :|.:|.||||:.....::      |:|||:
Zfish   254 --RCMETIAVWGVGGGDFEFPEVAGLPIGGNVGDFFYRLEVHYNNVNKTAGRV------DSSGLR 310

  Fly   428 IYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQCIEDCTGYAFPQ-----QGINIFAVM 487
            .|:|..||.:|||.|..|:.....:.|||..|..::.|.|  |.|  ..|:     ..:.:|:||
Zfish   311 FYYTSKLRQHDAGILMTGLAVIPSYAIPPKAKSFLTYGMC--DTT--YIPKVLETANDLQVFSVM 371

  Fly   488 MRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDRLIAECIYDSSSRKA 552
            |.||..|::|::...|:.:::..:|.|.|.:..:|....|.::.....||:|:.||.|::.:|..
Zfish   372 MHTHLAGRKVRVGHFREGKQIDLLAVDENYNFEFQQVTNLGKTKTVKLGDKLLVECTYNTENRNT 436

  Fly   553 ITLGGLTMKEESCTVLTLYYPRQKKLTTCHSLPSLPTVLHSLGIEQLATDSNPVLISSPPELAGM 617
            :|.|||:..:|.|.....|||.. .|:.|.|||...:::..:|    |.|:...|.         
Zfish   437 LTQGGLSTSDEMCLAFLFYYPAM-NLSGCESLPHFSSLVSEMG----AGDTGTWLY--------- 487

  Fly   618 TLEARLISYDW-ENQFGEFQEATRK 641
                .:.:..| ::...|:|:..:|
Zfish   488 ----MMNTMAWNDSSINEYQQTLKK 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 49/135 (36%)
Cu2_monooxygen 282..407 CDD:279429 34/126 (27%)
Cu2_monoox_C 438..583 CDD:281675 46/150 (31%)
moxd1lNP_001121997.1 DOMON_DOH 30..162 CDD:187689 48/135 (36%)
Cu2_monooxygen 182..299 CDD:279429 35/130 (27%)
Cu2_monoox_C 321..466 CDD:281675 46/150 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24408696
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10157
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.