DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and Moxd2

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001102699.1 Gene:Moxd2 RGDID:1564286 Length:619 Species:Rattus norvegicus

Alignment Length:563 Identity:165/564 (29%)
Similarity:251/564 (45%) Gaps:76/564 (13%)


  Fly    54 FNLFLLLLLLA--SGVRAASKLATRSNKTSGSSTASGVGAGTAATSAAAAAASGTPIWDHAIDLN 116
            |.||||.:|.|  .|.|.:.....|.::....|                          ||:.|.
  Rat     7 FRLFLLWVLAAFSQGKRLSPTSPLRYSRFLDPS--------------------------HAVFLR 45

  Fly   117 DDFRILWQIINQDITFEIQARTLGYVGFGFSPDGNLAGADMAIGWV-DKGQTYFQDRHVTRNGDP 180
            .||....:|    ||||:|.:|.|:||.|.:......|:|:.:|.| ..|..||.|:|:......
  Rat    46 WDFDYETEI----ITFELQVQTTGWVGLGITDRYTFVGSDLVVGGVLPNGNVYFSDQHLLDEDTL 106

  Fly   181 EPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTMRLLYMYHAQDPPHGSVRPG 245
            |.  |.|||..|:...|::..|.:||.|...:||| ||..||:||||:|..|...|.|.      
  Rat   107 EQ--DGSQDAELLKLTEDSVSTTMRFSRPFRSCDP-HDHDITSDTMRVLAAYGLDDIPK------ 162

  Fly   246 TLPDPARAFRPYRPMVLMQRAQLPMPSPTHDERVRVLELRNEDVELPAGDLPLFWCKMFKLEDIN 310
              .:..|.|  .:.:.|:|..|........|..:..|::.|  ..:|..| ..:.|....|..::
  Rat   163 --MNRERTF--VKSIFLLQILQYDDEDAPEDTVIYDLKISN--FLIPEED-TTYACTFLPLPIVS 220

  Fly   311 RKHHLIRYEPIY--DSSSSVHYLQHITLHECQGAHAELEEMAREQGRPCLGARSIPLACNAIVAS 373
            :|||:.::|||.  .:.:.||   |:.::.| |..:.|.....|    |.||......|:.::|.
  Rat   221 KKHHIYKFEPILVERNETMVH---HVLVYAC-GNSSVLPTGIGE----CYGADPAFSLCSHVIAG 277

  Fly   374 WSRGSEGFTYPHEAGYPIESR-QAKYYLMETHYNNLKPDFAQLHARQMADNSGLKIYFTHVLRPN 437
            |:.|...:.:|.:.|..|.:. ..::..:|.||:|    |..|..  :.|.||:::|:|..||..
  Rat   278 WAVGGLSYQFPDDVGISIGTPFDPQWIRLEIHYSN----FQNLPG--IRDTSGMRLYYTSHLRKY 336

  Fly   438 DAGTLSIGMDPNWRHIIPPGQKRVVSEGQC----IEDCTGYAFPQQGINIFAVMMRTHQIGKEVK 498
            |.|.|.:|:.....|.||||.:..:|.|.|    .|:..|  .|...|.:.|.::.||..|:.::
  Rat   337 DMGVLQLGISVFPIHFIPPGAEAFLSYGLCKTDKFEEMNG--APVADIYVSACLLHTHLAGRSLQ 399

  Fly   499 LRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDRLIAECIYDSSSRKAITLGGLTMKEE 563
            ..|.|...:|..:..|.:.|...|:.|.||..|...|||.|:.||.|.:..|..:|.||.:...|
  Rat   400 ALQYRNGTQLQIVCKDFSYDFNLQESRDLPHPVVIKPGDELLIECHYQTLDRDFMTFGGASTINE 464

  Fly   564 SCTVLTLYYPRQKKLTTCHSLPSLPTVLHSLGIEQLATDSNPV 606
            .|.:...|||| ..:::|...|.:..|.:.||.|   ...||:
  Rat   465 MCLIFFFYYPR-INISSCMGYPDIIYVTNELGEE---ASENPM 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 51/133 (38%)
Cu2_monooxygen 282..407 CDD:279429 32/128 (25%)
Cu2_monoox_C 438..583 CDD:281675 48/149 (32%)
Moxd2NP_001102699.1 DOMON_DOH 36..159 CDD:187689 50/156 (32%)
Cu2_monooxygen 193..314 CDD:279429 34/136 (25%)
Cu2_monoox_C 337..482 CDD:281675 48/148 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24403031
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T618095
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10157
Phylome 1 0.910 0.600 Consistency score
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.