DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and CG5235

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001261921.1 Gene:CG5235 FlyBaseID:FBgn0036565 Length:698 Species:Drosophila melanogaster

Alignment Length:697 Identity:193/698 (28%)
Similarity:297/698 (43%) Gaps:127/698 (18%)


  Fly   123 WQIINQD-ITFEIQARTLGYVGFGFSPDGNLAGADMAIGWVD--KGQTYFQDRH-VTRNGDPEPV 183
            |...|:: |.||:...|.|:.|.|||.||.||.|||.:.|||  .|.....|.| ........|:
  Fly    61 WINANENSIYFEVTVHTRGFAGLGFSKDGRLARADMVLMWVDDATGHPNVLDCHGALHPSSGPPL 125

  Fly   184 VDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTMRLLYMYHAQDPPHGSVRPGTLP 248
            .|.:|:|.::.|.:|.|||:|:|:||::|||| .||.::.||.::|:.....||.||::......
  Fly   126 QDDTQNYDVLDGKQNGTHTILKFKRKIETCDP-FDIPLSADTFKVLWSIGENDPIHGNLDWQGQS 189

  Fly   249 DPARAFRPYRPMVLMQRAQLPMPSPTHDERVRVLELRNEDVELPAGDLPLFWCKMFKLEDINRKH 313
            ...:|.:.:.||.......:        |.::..::...:|.:......|:|||:.:|.::..|.
  Fly   190 RGVKALQLFSPMFTKNSHSI--------EGIQKWDITVNNVTIDRSMDTLYWCKIVRLPELTGKQ 246

  Fly   314 HLIRYEPIYDSSSSVHYLQHITLHECQ-----GAHAELEEM-AREQGRPCLGARSIPL---ACNA 369
            |:|.|||:.......:.:.|:||.|||     |:.....:: .|..|..|......|.   :|:.
  Fly   247 HIIGYEPLLSGKYERNVVHHMTLFECQSKIYSGSDPSSWDLWVRSAGTVCNSNLLTPRDWDSCST 311

  Fly   370 IVASWSRGSEGFTYPHEAGYPIESRQ-AKYYLMETHYNNLKPDFAQLHARQMADNSGLKIYFTHV 433
            .||.||.||:|...|..||.|:.... ..||::|.||:|  ||     .::..|:||.:|::|..
  Fly   312 PVAVWSLGSDGQFLPPHAGIPMGGASGVSYYMLEIHYDN--PD-----GKESVDHSGFRIHYTPN 369

  Fly   434 LRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQCIEDCTGYAFPQQGINIFAVMMRTHQIGKEVK 498
            ||..|:|.|..|:..:...:||||||:..|.|.|...|:...||:.||.|.:..:.:||.|:.:.
  Fly   370 LRTYDSGILISGVSISETQLIPPGQKKYRSVGICGPSCSSVMFPKDGIKIISGTLHSHQAGRTIS 434

  Fly   499 LRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDRLIAECIYDSSSRKAITLGGLTMKEE 563
            ||.:|..:||.||..|.|.|..:|...:|......:|||.||.:|.|::..||..|.||.:.|||
  Fly   435 LRHVRSGKELNPIIVDENYDYRHQKVHQLANETVVLPGDYLITDCSYETKYRKRPTFGGYSTKEE 499

  Fly   564 SCTVLTLYYPRQKKLTTCHSLPSLPTVLHSLGIEQL---------------------------AT 601
            .|.....|||: .:::.|:|:..:........:.|.                           ||
  Fly   500 MCLTFITYYPK-IEMSGCYSMTPVREFFEMFRVYQFYSLNMTDVENMFLYNSDYTDYSKQAKNAT 563

  Fly   602 DS------------------NPVLISSPPELAGMTLEARLISYDWENQF--GEFQEATRKGSFKP 646
            :.                  |.::||.|.|....|..:.|....|.:..  ...::|...|:...
  Fly   564 NKPNSGKTSKEDVIYQESLLNKLVISDPAEFHDRTFLSHLNQLPWHDPLFTKRVEQAFITGTHMT 628

  Fly   647 ICWGAKNHVVPGSEFLEGYSINVTKTYKKHRRCKPKRPLAPPTERTAPPPASDLSELPVLHELDN 711
            .|..:|:.:...||.:.                      .|.......|||:.|:.|        
  Fly   629 FCRVSKDSLSIPSEIIR----------------------YPEFTAYVKPPAACLNYL-------- 663

  Fly   712 NNIIEGAARSSRSSATDVHSLSRGSGRHFISCLLWLGASSWWLLLML 758
                          .||...|..||.:.|....|     |..||:.|
  Fly   664 --------------FTDNEELRSGSSQFFTDFTL-----SLLLLIQL 691

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 50/124 (40%)
Cu2_monooxygen 282..407 CDD:279429 40/135 (30%)
Cu2_monoox_C 438..583 CDD:281675 54/145 (37%)
CG5235NP_001261921.1 DOMON 54..174 CDD:281361 46/114 (40%)
Cu2_monooxygen 214..354 CDD:279429 43/147 (29%)
Cu2_monoox_C 374..529 CDD:281675 55/156 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C23640191
eggNOG 1 0.900 E1_KOG3568
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 1 1.000 FOG0005662
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10157
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4667
65.970

Return to query results.
Submit another query.