DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and Tbh

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001284996.1 Gene:Tbh FlyBaseID:FBgn0010329 Length:670 Species:Drosophila melanogaster

Alignment Length:645 Identity:166/646 (26%)
Similarity:257/646 (40%) Gaps:166/646 (26%)


  Fly    53 TFNLFLLLLLLASGVRAASKLATRSNKTSGSSTASGVGAGTAATSAAAAAASGTPIWDHAIDLND 117
            ||...:||||:|:       |.||                  ..||.:...|.|.:  |.|.|:|
  Fly    66 TFMPVMLLLLMAT-------LLTR------------------PLSAFSNRLSDTKL--HEIYLDD 103

  Fly   118 -DFRILWQI--INQDITFEIQ---ARTLGYVGFGFSPDGNLAGADMAIGWVDKGQTYFQDRHVTR 176
             :.::.|.:  ..|::.|.:|   .....:...|||..|.||.||:.         :|::::...
  Fly   104 KEIKLSWMVDWYKQEVLFHLQNAFNEQHRWFYLGFSKRGGLADADIC---------FFENQNGFF 159

  Fly   177 NGDPEPVVDPS-----QDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTMRLLYMYHAQD 236
            |...:....|.     :||.............|.||||.|||||. |:.:...||.:::      
  Fly   160 NAVTDTYTSPDGQWVRRDYQQDCEVFKMDEFTLAFRRKFDTCDPL-DLRLHEGTMYVVW------ 217

  Fly   237 PPHGSVRPGTLPDPARAFRPYRPMVLMQRAQLPMPSPT--HDERVRVLELRNED----------- 288
                          ||.    ...:.::..|..:|:.|  |:..|::|:|...|           
  Fly   218 --------------ARG----ETELALEDHQFALPNVTAPHEAGVKMLQLLRADKILIPETELDH 264

  Fly   289 VELPAGDLPL------FWCKMFKLE-DINRKHHLIRYEPIYDSSSSVHYLQHITLHECQ-GAHAE 345
            :|:...:.|:      :||.:.:|| ::.|:||::::||:..:...||   |:.:..|: |.|.|
  Fly   265 MEITLQEAPIPSQETTYWCHVQRLEGNLRRRHHIVQFEPLIRTPGIVH---HMEVFHCEAGEHEE 326

  Fly   346 LEEMAREQGRPCLGARSIPL-------------ACNAIVASWSRGSEGFTYPHEAGYPIESRQAK 397
                             |||             .|:.::..|:.|:..||||.|||.||......
  Fly   327 -----------------IPLYNGDCEQLPPRAKICSKVMVLWAMGAGTFTYPPEAGLPIGGPGFN 374

  Fly   398 YYL-METHYNNLKPDFAQLHARQ--MADNSGLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQK 459
            .|: :|.|:||  |:      :|  :.||||.:|..:..||..||..:.:|::...:..|||||.
  Fly   375 PYVRLEVHFNN--PE------KQSGLVDNSGFRIKMSKTLRQYDAAVMELGLEYTDKMAIPPGQT 431

  Fly   460 RVVSEGQCIEDCTGYAFPQQGINIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDF 524
            .....|.|:.|||..|.|..||.||...:.||..|..|..|..|..:||..:..|......:|:.
  Fly   432 AFPLSGYCVADCTRAALPATGIIIFGSQLHTHLRGVRVLTRHFRGEQELREVNRDDYYSNHFQEM 496

  Fly   525 RRLPQSVHSMPGDRLIAECIYDSSSRKAITLGGLTMKEESCTVLTLYYPRQKKLTTCHSLPSLPT 589
            |.|......:|||.|:..|.|::...|...|||.::.:|.|.....||| ..||..|.|..|..|
  Fly   497 RTLHYKPRVLPGDALVTTCYYNTKDDKTAALGGFSISDEMCVNYIHYYP-ATKLEVCKSSVSEET 560

  Fly   590 VLHSLGIEQLATDSNPVLISSPPELAGMTLEARLISYDWENQFGEFQEATRKGSFKPICW 649
             |.:..|....|                           |:|.|......|..:::.|.|
  Fly   561 -LENYFIYMKRT---------------------------EHQHGVHLNGARSSNYRSIEW 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 34/143 (24%)
Cu2_monooxygen 282..407 CDD:279429 40/158 (25%)
Cu2_monoox_C 438..583 CDD:281675 49/145 (34%)
TbhNP_001284996.1 DOMON 102..220 CDD:281361 33/148 (22%)
Cu2_monooxygen 264..389 CDD:279429 39/153 (25%)
Cu2_monoox_C 410..565 CDD:281675 53/157 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24425570
eggNOG 1 0.900 E1_KOG3568
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10157
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.