DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and dbh

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001103164.1 Gene:dbh ZFINID:ZDB-GENE-990621-3 Length:614 Species:Danio rerio

Alignment Length:579 Identity:158/580 (27%)
Similarity:257/580 (44%) Gaps:73/580 (13%)


  Fly    94 AATSAAAAAASGTPIWDHAIDLNDDFRILWQII--NQDITFEIQARTLGY-VGFGFSPDGNLAGA 155
            |:..|.|..:..|..:...:|.:....:.|.|.  .|::..|::.:.|.: :..|.|..|....|
Zfish    30 ASYQAPAGQSRPTLAYHIPLDPSGQLELSWNISYPKQEVLLEVKVKELHHGIILGMSDRGEPTNA 94

  Fly   156 DMAIGWVDKGQTYFQDRHVTRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIA 220
            |:.|.|.|..::||.|......|  ...:|..|||.|:..:::.....|.|:|...|||| ||..
Zfish    95 DLVILWDDGHKSYFGDAWSDSEG--RVTLDTQQDYQLLETHQSTEGFFLLFKRSFSTCDP-HDYI 156

  Fly   221 ITNDTMRLLY--MYHAQDPPH----GSVRPGTLPDPARAFRPYRPMVLMQRAQLPMPSPTHDERV 279
            |...|:.::|  :.|.....|    ..::||.            ..||:.|...|.|....|  |
Zfish   157 IEEGTVHIIYTMLEHPILSLHELNISRLQPGV------------QRVLLLRPDTPSPHLPKD--V 207

  Fly   280 RVLELRNEDVELPAGDLPLFWCKMFKLEDINRKHHLIRYEPIY--DSSSSVHYLQHITLHECQGA 342
            |.||:...||.:|..: ..:||.:::|.....|:|::.||.:.  .:.:.||   ||.:.||.  
Zfish   208 RTLEVLAPDVIIPTQE-TTYWCHIYQLPPNLPKNHIVMYESVITPGNEAIVH---HIEVFECS-- 266

  Fly   343 HAELEEMAREQGRPC---LGARSIPLACNAIVASWSRGSEGFTYPHEAGYPIESRQAKYYL-MET 403
             .:::.:.:..| .|   :..|::.. |..::|:|:.|:|.|.||.:||.|:....:..:| :|.
Zfish   267 -PQMDIVPQYSG-SCDSKMKPRNLNY-CRHVLAAWAMGAEPFYYPADAGLPMGGEGSSRFLRLEV 328

  Fly   404 HYNNLKPDFAQLHARQMADNSGLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQCI 468
            ||:|      .|......|:||::::::..||..|||.:.:|:.......|||.|:.....|.|.
Zfish   329 HYHN------PLLLSGRRDSSGIRLWYSPSLRRFDAGIMELGLVYTPVMAIPPRQRSFQLTGYCT 387

  Fly   469 EDCTGYAFPQQGINIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHS 533
            ..||..|.|..||:|||..:.||..|..|:...:|..:|:..:..|.:....||..|.|.:.|..
Zfish   388 AKCTQTALPVGGIHIFASQLHTHLAGLGVRTVLVRGGQEVEVVQEDKHFSTHYQIIRVLQKMVTV 452

  Fly   534 MPGDRLIAECIYDSSSRKAITLGGLTMKEESCTVLTLYYPR-QKKLTTCH----------SL--- 584
            :|||.|:..|.:::..|..:|:||..:.||.|.....|||| |.:|...|          ||   
Zfish   453 LPGDALLTTCRFNTEDRSKVTVGGFGIMEEMCVNYVHYYPRTQLELCKSHVDTDYLQKYFSLINR 517

  Fly   585 ------PSLPTVLHSLGIEQLATDS------NPVLISSPPELAGMTLEARLISYDWENQ 631
                  .|.|..........::.||      |.:.:::|..:......|:|...|||.|
Zfish   518 FQGRESCSCPQTSVEEQFSSVSWDSFSGEVLNSLYVTAPFSMHCNQSTAQLFPGDWEKQ 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 37/141 (26%)
Cu2_monooxygen 282..407 CDD:279429 36/131 (27%)
Cu2_monoox_C 438..583 CDD:281675 50/156 (32%)
dbhNP_001103164.1 DOMON 52..168 CDD:281361 34/119 (29%)
Cu2_monooxygen 209..336 CDD:279429 38/142 (27%)
Cu2_monoox_C 357..512 CDD:281675 50/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.