DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and Moxd1

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_001054130.2 Gene:Moxd1 RGDID:1310033 Length:613 Species:Rattus norvegicus

Alignment Length:688 Identity:220/689 (32%)
Similarity:327/689 (47%) Gaps:124/689 (18%)


  Fly    94 AATSAAAAAASGTPIWDHAIDLNDD--FRILWQIINQDITFEIQARTLGYVGFGFSPDGNLAGAD 156
            |...|.||.:||.. :.|.:.|:.:  :.:||....:.:.|.::.||.|||||||||.|.:|.||
  Rat    11 ALLPATAAGSSGRS-YPHRVVLDPEGKYWLLWGRQGERLAFRLEVRTNGYVGFGFSPTGTMAAAD 74

  Fly   157 MAIGWVDKGQTYFQDRHVTRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAI 221
            :.:|.|..|:.|.||...  |.|.|...|..|||.|....||:||||:.|.|.|.||| ::|.::
  Rat    75 IVVGGVAHGRPYLQDYFT--NADKELEKDAQQDYHLDYAMENSTHTVIEFSRDLHTCD-ANDKSL 136

  Fly   222 TNDTMRLLYMYHAQDPP------HGSVRPGTLPDPARAFRPYRPMVLMQRAQLPMPSPTHDERVR 280
            |:.|:|:::.||.:||.      |.|.| ||  ...|...|.:..||  ...||           
  Rat   137 TDSTVRVIWAYHHEDPGESGPKYHDSNR-GT--KSLRLLNPEKASVL--STVLP----------- 185

  Fly   281 VLELRNEDVELPAGDLPLFWCKMFKLEDINRKHHLIRYEPIYD--SSSSVHYLQHITLHECQGAH 343
            ..:|.|::|.:| .....:||:|||:.....|||:|:.|||.:  ..|.||   ||.|::|.   
  Rat   186 YFDLVNQNVPIP-NKGTTYWCQMFKIPIFQEKHHVIKVEPIIERGHESLVH---HILLYQCS--- 243

  Fly   344 AELEEMAREQGRPCLGARSIP---LACNAIVASWSRGSEGFTYPHEA----GYPIESRQAKYYLM 401
            :...:...:.|..|... ::|   |.|..::.:|..|.||||||...    |.|.:.|   |.|:
  Rat   244 SNFNDSVLDFGHECYHP-NMPDAFLTCETVIFAWGIGGEGFTYPPHVGLSLGMPPDPR---YVLL 304

  Fly   402 ETHYNNLKPDFAQLHARQMADNSGLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQ 466
            |.||:|      ....:.:.|:|||:.:.|...|..|||.:..|:..:..|.||||.....|||.
  Rat   305 EVHYDN------PARKKGLIDSSGLRFFHTTDTRRYDAGVIEAGLWVSLFHTIPPGMPEFRSEGH 363

  Fly   467 CIEDCTGYAFPQQ---GINIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLP 528
            |..:|...|...:   ||::|||::..|..||.::||..|:.||:..:|:|.:.|..:|:|:.|.
  Rat   364 CTRECLEEALGTEKPSGIHVFAVLLHAHLSGKGIRLRHFRKGEEMQLLAYDDDYDFNFQEFQYLR 428

  Fly   529 QSVHSMPGDRLIAECIYDSSSRKAITLGGLTMKEESCTVLTLYYPRQKKLTTCHSLPSLPTVLHS 593
            :....:|||.||.||.|::..|.|:|.|||:.:.|.|....||||| ..||.|.|:|.:...|..
  Rat   429 EEQTILPGDNLITECRYNTKDRAAMTWGGLSTRNEMCLSYLLYYPR-INLTRCTSIPDIMDQLQF 492

  Fly   594 LGIEQL--ATDSNPVLISSPPELAGMTLEARLISYDWENQFGEFQEATRKGSFKPICWGAKNHVV 656
            :|::::  ...:.|.:|.||.:...::                |.:|..|  ||   |..|    
  Rat   493 IGVKEIYRPVTTWPFIIKSPKQYRNLS----------------FMDAMNK--FK---WTKK---- 532

  Fly   657 PGSEFLEGYSIN-VTKTYKKHRRCKPKRPLAPPTE-----RTAPPPASDLSELPVLHELDNNNII 715
                  ||.|.| :..:...:.||..    |...|     .||.||  |:.: |...|    .::
  Rat   533 ------EGVSFNKLVLSLPVNMRCSK----ADNAEWSIQGMTALPP--DIKK-PYKAE----PLV 580

  Fly   716 EGAARSSRSSATDVHSLSRGSGRHF----ISCLLWLGA 749
            .|.:.|||     :|.:       |    :.|.|.||:
  Rat   581 CGTSASSR-----LHGV-------FPLPLLGCSLLLGS 606

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 56/140 (40%)
Cu2_monooxygen 282..407 CDD:279429 44/134 (33%)
Cu2_monoox_C 438..583 CDD:281675 58/148 (39%)
Moxd1XP_001054130.2 DOMON_DOH 31..165 CDD:187689 56/138 (41%)
Cu2_monooxygen 186..314 CDD:279429 45/145 (31%)
Cu2_monoox_C 335..482 CDD:281675 58/148 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24404506
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H22904
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 1 1.000 FOG0005662
OrthoInspector 1 1.000 T618095
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10157
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.900

Return to query results.
Submit another query.