DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and MOXD1

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_056344.2 Gene:MOXD1 HGNCID:21063 Length:613 Species:Homo sapiens

Alignment Length:691 Identity:215/692 (31%)
Similarity:323/692 (47%) Gaps:122/692 (18%)


  Fly    88 GVGAGTAATSAAAAAASGTPIWDHAIDLNDDFRILWQIINQDITFEIQARTLGYVGFGFSPDGNL 152
            |:..||||..:.......|     .:|....:.:.|......|.|.:|.||.|||||||||.|.:
Human    11 GLLPGTAAGGSGRTYPHRT-----LLDSEGKYWLGWSQRGSQIAFRLQVRTAGYVGFGFSPTGAM 70

  Fly   153 AGADMAIGWVDKGQTYFQDRHVTRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSH 217
            |.||:.:|.|..|:.|.||...  |.:.|...|..|||.|....||:|||::.|.|:|.||| .:
Human    71 ASADIVVGGVAHGRPYLQDYFT--NANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCD-IN 132

  Fly   218 DIAITNDTMRLLYMYHAQD-----PPHGSVRPGTLPDPARAFRPYRPMVLMQRAQLPMPSPTHDE 277
            |.:||:.|:|:::.||.:|     |.:.....||  ...|...|.:..||  ...||        
Human   133 DKSITDSTVRVIWAYHHEDAGEAGPKYHDSNRGT--KSLRLLNPEKTSVL--STALP-------- 185

  Fly   278 RVRVLELRNEDVELPAGDLPLFWCKMFKLEDINRKHHLIRYEPIYD--SSSSVHYLQHITLHECQ 340
               ..:|.|:||.:|..| ..:||:|||:.....|||:|:.||:..  ..|.||   ||.|::|.
Human   186 ---YFDLVNQDVPIPNKD-TTYWCQMFKIPVFQEKHHVIKVEPVIQRGHESLVH---HILLYQCS 243

  Fly   341 GAHAELEEMAREQGRPCLGARSIP---LACNAIVASWSRGSEGFTYPHEAGY----PIESRQAKY 398
            .   ...:...|.|..|... ::|   |.|..::.:|:.|.|||:||...|.    |::..   |
Human   244 N---NFNDSVLESGHECYHP-NMPDAFLTCETVIFAWAIGGEGFSYPPHVGLSLGTPLDPH---Y 301

  Fly   399 YLMETHYNNLKPDFAQLHARQMADNSGLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVS 463
            .|:|.||:|  |.:.:    .:.|||||::::|..:|..|||.:..|:..:..|.||||.....|
Human   302 VLLEVHYDN--PTYEE----GLIDNSGLRLFYTMDIRKYDAGVIEAGLWVSLFHTIPPGMPEFQS 360

  Fly   464 EGQCIEDCTGYAFPQQ---GINIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFR 525
            ||.|..:|...|...:   ||::|||::..|..|:.::||..|:.:|:..:|:|.:.|..:|:|:
Human   361 EGHCTLECLEEALEAEKPSGIHVFAVLLHAHLAGRGIRLRHFRKGKEMKLLAYDDDFDFNFQEFQ 425

  Fly   526 RLPQSVHSMPGDRLIAECIYDSSSRKAITLGGLTMKEESCTVLTLYYPRQKKLTTCHSLPSLPTV 590
            .|.:....:|||.||.||.|::..|..:|.|||:.:.|.|....||||| ..||.|.|:|.:...
Human   426 YLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPR-INLTRCASIPDIMEQ 489

  Fly   591 LHSLGIEQL--ATDSNPVLISSPPELAGMTLEARLISYDWENQFGEFQEATRKGSFKPICWGAKN 653
            |..:|::::  ...:.|.:|.||.:...::                |.:|..|  ||   |..| 
Human   490 LQFIGVKEIYRPVTTWPFIIKSPKQYKNLS----------------FMDAMNK--FK---WTKK- 532

  Fly   654 HVVPGSEFLEGYSIN-VTKTYKKHRRCKPKRPLAPPTER--------TAPPPASDLSELPVLHEL 709
                     ||.|.| :..:...:.||.       .|:.        ||.||  |: |.|...| 
Human   533 ---------EGLSFNKLVLSLPVNVRCS-------KTDNAEWSIQGMTALPP--DI-ERPYKAE- 577

  Fly   710 DNNNIIEGAARSSRSSATDVHSLSRGSGRHFISCLLWLGAS 750
               .::.|.:.||        ||.|....:.:.|||.|..:
Human   578 ---PLVCGTSSSS--------SLHRDFSINLLVCLLLLSCT 607

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 53/137 (39%)
Cu2_monooxygen 282..407 CDD:279429 44/134 (33%)
Cu2_monoox_C 438..583 CDD:281675 55/148 (37%)
MOXD1NP_056344.2 DOMON_DOH 29..165 CDD:187689 54/144 (38%)
Cu2_monooxygen 186..312 CDD:279429 46/139 (33%)
Cu2_monoox_C 335..482 CDD:281675 55/148 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24388405
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H22904
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5865
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 1 1.000 FOG0005662
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10157
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4667
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.