DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and Dbh

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_037290.2 Gene:Dbh RGDID:2489 Length:621 Species:Rattus norvegicus

Alignment Length:525 Identity:151/526 (29%)
Similarity:246/526 (47%) Gaps:59/526 (11%)


  Fly   113 IDLNDDFRILWQI-INQDI---TFEIQARTLGYVGFGFSPDGNLAGADMAIGWVDKGQTYFQDRH 173
            :|......:.|.: .:|:|   ..::|....| |.||.|..|.:..||:.:.|.|..:|||.|..
  Rat    56 LDPEGTLELSWNVSYDQEIIHFQLQVQGPRAG-VLFGMSDRGEMENADLVMLWTDGDRTYFADAW 119

  Fly   174 VTRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTMRLLYMYHAQDPP 238
            ..:.|...  :|..|||.|:.....:....|.|:|...||||. |..|.:||:.|:|        
  Rat   120 SDQKGQIH--LDTHQDYQLLQAQRVSNSLSLLFKRPFVTCDPK-DYVIEDDTVHLVY-------- 173

  Fly   239 HGSVRPGTLPDPARAFRPYRPMVL---MQRAQLPMP---SPTHDERVRVLELRNEDVELPAGDLP 297
                  |.|.:|.::........|   :|:.||..|   :|.....|:.:::|..||.:|:.: .
  Rat   174 ------GILEEPFQSLEAINTSGLHTGLQQVQLLKPEVSTPAMPADVQTMDIRAPDVLIPSTE-T 231

  Fly   298 LFWCKMFKLEDINRKHHLIRYEPIYDSSSS--VHYLQHITLHECQGAHAELEEMAREQGRPCLGA 360
            .:||.:.:|.....:||:|.||.|....:.  ||   |:.:.:|..   |.|......| || .:
  Rat   232 TYWCYITELPLHFPRHHIIMYEAIVTEGNEALVH---HMEVFQCTN---ESEAFPMFNG-PC-DS 288

  Fly   361 RSIP---LACNAIVASWSRGSEGFTYPHEAGYPI-ESRQAKYYLMETHYNNLKPDFAQLHARQMA 421
            :..|   ..|..::|:|:.|::.|.||.|||.|: .|..:::..:|.||:|.:    .:..|:  
  Rat   289 KMKPDRLNYCRHVLAAWALGAKAFYYPEEAGVPLGSSGSSRFLRLEVHYHNPR----NIQGRR-- 347

  Fly   422 DNSGLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQCIEDCTGYAFPQQGINIFAV 486
            |:||:::::|..||||:||.:.:|:.......|||.:...|..|.|.:.||..|.|:.||.|||.
  Rat   348 DSSGIRLHYTASLRPNEAGIMELGLVYTPLMAIPPQETTFVLTGYCTDRCTQMALPKSGIRIFAS 412

  Fly   487 MMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDRLIAECIYDSSSRK 551
            .:.||..|::|.....|..::...:..|::....:|:.|.|..:|....||.||..|.|::.:|.
  Rat   413 QLHTHLTGRKVITVLARDGQQREVVNRDNHYSPHFQEIRMLKNAVTVHQGDVLITSCTYNTENRT 477

  Fly   552 AITLGGLTMKEESCTVLTLYYPRQKKLTTCHS------LPSLPTVLHSLGIEQLAT---DSNPVL 607
            ..|:||..:.||.|.....|||: .:|..|.|      |.....:::..|.|::.|   .|.|..
  Rat   478 MATVGGFGILEEMCVNYVHYYPK-TELELCKSAVDDGFLQKYFHIVNRFGNEEVCTCPQASVPQQ 541

  Fly   608 ISSPP 612
            .:|.|
  Rat   542 FASVP 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 38/134 (28%)
Cu2_monooxygen 282..407 CDD:279429 38/131 (29%)
Cu2_monoox_C 438..583 CDD:281675 46/145 (32%)
DbhNP_037290.2 DOMON 60..175 CDD:281361 38/133 (29%)
Cu2_monooxygen 216..340 CDD:279429 39/133 (29%)
Cu2_monoox_C 364..519 CDD:281675 48/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.