DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and Moxd2

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_647457.2 Gene:Moxd2 MGIID:2388042 Length:619 Species:Mus musculus

Alignment Length:563 Identity:165/564 (29%)
Similarity:250/564 (44%) Gaps:76/564 (13%)


  Fly    54 FNLFLLLLLLA--SGVRAASKLATRSNKTSGSSTASGVGAGTAATSAAAAAASGTPIWDHAIDLN 116
            |.|||||:|.|  .|.|.......|.::....|                          .|:.|.
Mouse     7 FRLFLLLVLAAFSQGKRLGPTSPLRYSRFLDPS--------------------------RAVFLR 45

  Fly   117 DDFRILWQIINQDITFEIQARTLGYVGFGFSPDGNLAGADMAIGWV-DKGQTYFQDRHVTRNGDP 180
            .||....:|    ||||:|.:|.|:||.|.:......|:|:.:|.| ..|..||.|:|:......
Mouse    46 WDFDYEAEI----ITFELQVQTTGWVGLGITDRYTFVGSDLVVGGVLPNGNVYFSDQHLLDEDTL 106

  Fly   181 EPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTMRLLYMYHAQDPPHGSVRPG 245
            |.  |.|||..|:...|:|..|.:||.|...|||| ||..||:||||:|..|          .|.
Mouse   107 EQ--DGSQDAELLRLTEDAVSTTMRFSRPFRTCDP-HDRDITSDTMRVLAAY----------GPD 158

  Fly   246 TLPDPARAFRPYRPMVLMQRAQLPMPSPTHDERVRVLELRNEDVELPAGDLPLFWCKMFKLEDIN 310
            .:|..:|.....:.:.|:|..|........|..:..|::.|  ..:|..| ..:.|....|..::
Mouse   159 DIPKMSREHTFVKSIFLLQMLQYDDQDAPEDTIIHDLKISN--FIIPEDD-TTYACTFLPLPIVS 220

  Fly   311 RKHHLIRYEPIY--DSSSSVHYLQHITLHECQGAHAELEEMAREQGRPCLGARSIPLACNAIVAS 373
            :|||:.::|||.  .:.:.||   |:.::.| |..:.|.....|    |.|:......|:.::|.
Mouse   221 KKHHIYKFEPILVERNETMVH---HVLVYAC-GNSSVLPTGIGE----CYGSDPAFSLCSHVIAG 277

  Fly   374 WSRGSEGFTYPHEAGYPIESR-QAKYYLMETHYNNLKPDFAQLHARQMADNSGLKIYFTHVLRPN 437
            |:.|...:.:|.:.|..|.:. ..::..:|.||:|    |..|..  :.|.||:::::|..||..
Mouse   278 WAVGGLSYQFPDDVGISIGTPFDPQWIRLEIHYSN----FQNLPG--IRDTSGMRLFYTSHLRKY 336

  Fly   438 DAGTLSIGMDPNWRHIIPPGQKRVVSEGQC----IEDCTGYAFPQQGINIFAVMMRTHQIGKEVK 498
            |.|.|.:|:.....|.||||.:..:|.|.|    .|:..|  .|...|.|.|.::.||..|:.::
Mouse   337 DMGVLQLGISVFPIHFIPPGAEAFLSYGLCKTDKFEELNG--APVSDIYISACLLHTHLAGRSLQ 399

  Fly   499 LRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDRLIAECIYDSSSRKAITLGGLTMKEE 563
            ..|.|...:|..:..|.:.|...|:.|.||..|...|||.|:.||.|.:..|..:|.||.:...|
Mouse   400 ALQYRNGTQLQVVCKDFSYDFNLQESRDLPHPVVIKPGDELLIECHYQTLDRDFMTFGGASTINE 464

  Fly   564 SCTVLTLYYPRQKKLTTCHSLPSLPTVLHSLGIEQLATDSNPV 606
            .|.:...|||| ..:::|...|.:..|.:.||.|   ...||:
Mouse   465 MCLIFFFYYPR-INISSCMGYPDIIYVTNELGEE---ASENPM 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 50/133 (38%)
Cu2_monooxygen 282..407 CDD:279429 31/128 (24%)
Cu2_monoox_C 438..583 CDD:281675 49/149 (33%)
Moxd2NP_647457.2 DOMON_DOH 36..172 CDD:187689 54/179 (30%)
Cu2_monooxygen 194..314 CDD:279429 33/135 (24%)
Cu2_monoox_C 337..482 CDD:281675 49/148 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24394217
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10157
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.