DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and tbh-1

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001257264.1 Gene:tbh-1 WormBaseID:WBGene00006541 Length:657 Species:Caenorhabditis elegans

Alignment Length:655 Identity:169/656 (26%)
Similarity:264/656 (40%) Gaps:129/656 (20%)


  Fly    25 SPAATLRHSRTASSSRRLSLIRCFISCHTFNLFLLLLLLA--SGVRAASKLATRSNKTSGSSTAS 87
            |..:|:|.|..|||...|...|...|.    :.||.||:|  .||..|.::......|       
 Worm    50 SSVSTVRWSSGASSYVILGEYRKMRSA----VALLFLLVAYCGGVVHAGEIVAELYHT------- 103

  Fly    88 GVGAGTAATSAAAAAASGTPIW--DHAIDLNDDFRILWQIINQDITFEIQARTLGYVGFGFSPDG 150
                            :.|..|  |:...| .||.|.:.....|:.|           .|||..|
 Worm   104 ----------------NVTVKWHTDYERQL-VDFSIWFGASTPDVLF-----------LGFSDFG 140

  Fly   151 NLAGADMAIGWVDKGQTYFQDRHVTRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDP 215
            :...:|:.:.:..|.:  .:|.:..|  |.:...|..||:.|:  .:...|.|:  ||||.||| 
 Worm   141 DTNNSDVLMYYNSKKE--IKDAYTNR--DFKITSDLQQDFQLL--RKRKDHIVV--RRKLTTCD- 196

  Fly   216 SHDIAITNDTMRLLYMYHAQ-----------------DPPHGSV------RPGTLPDPARAFRPY 257
            |.|.|....|.:   .|.|.                 |...|.|      :|....:||...:..
 Worm   197 SRDYAFLPGTTQ---FYIAASWGSTNLVDIRDKRWVVDKKFGKVIEGPTDQPNIEEEPAALEKDV 258

  Fly   258 RPMVLMQRAQLPMPSPTHDERVRVLELRNEDVELPAGDLPLFWCKMFKL--EDINRKHHLIRYEP 320
            :.:::...:..|:|                :||      ..:.|.:.|:  :.:|..:|::|.||
 Worm   259 KVVIVNSNSPDPIP----------------NVE------TTYKCIIRKMPFDTVNNMYHVVRMEP 301

  Fly   321 IYDSSSSVHYLQHITLHECQGAHAELEEMAREQGRPCLGARSIPLACNAIVASWSRGSEGFTYPH 385
             |.:..:.|.:.|:.:..|:.   |:||.:.....|....:|  .:|:.::|:|:.|.....||.
 Worm   302 -YVTPGNEHLVHHMEIFMCRD---EVEEWSGSCNDPKKPPKS--KSCSHVIAAWAMGEGPIHYPK 360

  Fly   386 EAGYPIESRQAKYYLM-ETHYNNLKPDFAQLHARQMADNSGLKIYFTHVLRPNDAGTLSIGMDPN 449
            |||.||..:....|:| |.||||     .:|| :.:.|:||.:.:.|..||..|||.:.:|:..:
 Worm   361 EAGLPIGGKGKNAYVMVEIHYNN-----PELH-KGVIDSSGFQFFVTGQLRKYDAGIMELGLIYS 419

  Fly   450 WRHIIPPGQKRVVSEGQCIEDCTGYAFPQQGINIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHD 514
            ..:.:||.||.....|.|...|| ...|::||||||..:..|..|:::...|.|....:..:..|
 Worm   420 DANSVPPNQKAWAMNGYCPSQCT-KNLPEEGINIFASQLHAHLTGRKLFTSQYRSGVRIGDVNRD 483

  Fly   515 SNIDVAYQDFRRLPQSVHSMPGDRLIAECIYDSSSRKAITLGGLTMKEESCTVLTLYYPRQKKLT 579
            .:....:|..::|...|..||||.|:..|:||:..|..:|.||..:.:|.|.....||| ...:.
 Worm   484 EHYSPHWQHLQQLRPVVKVMPGDTLVTTCVYDTRKRSKVTFGGYRIVDEMCVNYIYYYP-ASDVE 547

  Fly   580 TCHSLPSLPTVLHSLGIEQLATDSNPVLISSPPELAGMTLEARLISYDWENQFG-EFQEATRKGS 643
            .|.|..|..| |.:...|:...|...:.||.      |....:    ||.|... ||......|:
 Worm   548 VCKSAISNST-LRAYFSERHGMDGKRMQISD------MYSNVK----DWGNGVDEEFYNVLNVGN 601

  Fly   644 FKPIC 648
            ....|
 Worm   602 MNMNC 606

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 37/155 (24%)
Cu2_monooxygen 282..407 CDD:279429 35/128 (27%)
Cu2_monoox_C 438..583 CDD:281675 45/145 (31%)
tbh-1NP_001257264.1 DOMON 102..215 CDD:281361 38/160 (24%)
Cu2_monooxygen 270..387 CDD:279429 39/150 (26%)
Cu2_monoox_C 408..562 CDD:281675 49/157 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10157
Phylome 1 0.910 0.730 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.