DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and DBH

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_000778.3 Gene:DBH HGNCID:2689 Length:617 Species:Homo sapiens

Alignment Length:519 Identity:151/520 (29%)
Similarity:236/520 (45%) Gaps:55/520 (11%)


  Fly    84 STASGVGAGTAATSAAAAAASGTPIWDH-AIDLNDDFRILWQI--INQDITFEIQARTL-GYVGF 144
            |||..:.......:...:|...:|:..| .:|......:.|.:  ..:.|.|::..|.| ..|.|
Human    23 STAVAIFLVILVAALQGSAPRESPLPYHIPLDPEGSLELSWNVSYTQEAIHFQLLVRRLKAGVLF 87

  Fly   145 GFSPDGNLAGADMAIGWVDKGQTYFQDRHVTRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRK 209
            |.|..|.|..||:.:.|.|....||.|....:.|...  :||.|||.|:..........|.|:|.
Human    88 GMSDRGELENADLVVLWTDGDTAYFADAWSDQKGQIH--LDPQQDYQLLQVQRTPEGLTLLFKRP 150

  Fly   210 LDTCDPSHDIAITNDTMRLLYMYHAQDPPHGSVRPGTLPDPARAFRPYRPMVL---MQRAQL--- 268
            ..||||. |..|.:.|:.|:|              |.|.:|.|:........|   :||.||   
Human   151 FGTCDPK-DYLIEDGTVHLVY--------------GILEEPFRSLEAINGSGLQMGLQRVQLLKP 200

  Fly   269 PMPSPTHDERVRVLELRNEDVELPAGDLPLFWCKMFKLEDINRKHHLIRYEPIYDSSSS--VHYL 331
            .:|.|........:|::..::::|:.: ..:||.:.:|.....:||:|:||||....:.  ||  
Human   201 NIPEPELPSDACTMEVQAPNIQIPSQE-TTYWCYIKELPKGFSRHHIIKYEPIVTKGNEALVH-- 262

  Fly   332 QHITLHECQGAHAELEEMAREQGRPCLGARSIP---LACNAIVASWSRGSEGFTYPHEAGY---- 389
             |:.:.:|.   .|::.:....| || .::..|   ..|..::|:|:.|::.|.||.|||.    
Human   263 -HMEVFQCA---PEMDSVPHFSG-PC-DSKMKPDRLNYCRHVLAAWALGAKAFYYPEEAGLAFGG 321

  Fly   390 PIESRQAKYYLMETHYNNLKPDFAQLHARQMADNSGLKIYFTHVLRPNDAGTLSIGMDPNWRHII 454
            |..||   |..:|.||:|      .|......|:||:::|:|..||..:||.:.:|:.......|
Human   322 PGSSR---YLRLEVHYHN------PLVIEGRNDSSGIRLYYTAKLRRFNAGIMELGLVYTPVMAI 377

  Fly   455 PPGQKRVVSEGQCIEDCTGYAFPQQGINIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDV 519
            ||.:...:..|.|.:.||..|.|..||:|||..:.||..|::|....:|...|...:..|::...
Human   378 PPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLVRDGREWEIVNQDNHYSP 442

  Fly   520 AYQDFRRLPQSVHSMPGDRLIAECIYDSSSRKAITLGGLTMKEESCTVLTLYYPRQKKLTTCHS 583
            .:|:.|.|.:.|...|||.||..|.|::..|:..|:||..:.||.|.....||| |.:|..|.|
Human   443 HFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGGFGILEEMCVNYVHYYP-QTQLELCKS 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 39/136 (29%)
Cu2_monooxygen 282..407 CDD:279429 38/134 (28%)
Cu2_monoox_C 438..583 CDD:281675 48/145 (33%)
DBHNP_000778.3 DOMON 57..172 CDD:281361 38/132 (29%)
Cu2_monooxygen 213..337 CDD:279429 39/142 (27%)
Cu2_monoox_C 362..516 CDD:281675 49/146 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.