DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and Dbh

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_620392.2 Gene:Dbh MGIID:94864 Length:622 Species:Mus musculus

Alignment Length:612 Identity:173/613 (28%)
Similarity:271/613 (44%) Gaps:84/613 (14%)


  Fly   113 IDLNDDFRILWQI--INQDITFEIQARTL-GYVGFGFSPDGNLAGADMAIGWVDKGQTYFQDRHV 174
            :|......:.|.:  :.:.|.|::|.:.| ..|.||.|..|.:..||:.:.|.|..:.||.|...
Mouse    57 LDPEGILELSWNVSYVQEIIHFQLQVQGLRAGVLFGMSDRGEMENADLIMLWTDGDRAYFADAWS 121

  Fly   175 TRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTMRLLYMYHAQDPPH 239
            .|.|...  :|..|||.|:..........|.|:|...||||. |..|.:||:.|:|         
Mouse   122 DRKGQIH--LDSQQDYQLLQAQRTRDGLSLLFKRPFVTCDPK-DYVIEDDTVHLVY--------- 174

  Fly   240 GSVRPGTLPDPARAFRPYRPMVL---MQRAQL---PMPSPTHDERVRVLELRNEDVELPAGDLPL 298
                 |.|.:|.::........|   :||.||   .:|:|:..|.|:.:::|..|:.:|..: ..
Mouse   175 -----GILEEPFQSLEAINTSGLHTGLQRVQLLKSEVPTPSMPEDVQTMDIRAPDILIPDNE-TT 233

  Fly   299 FWCKMFKLEDINRKHHLIRYEPIYDSSSS--VHYLQHITLHECQGAHAELEEMAREQGRPCLGAR 361
            :||.:.:|.....:||:|.||.|....:.  ||   |:.:.:|.   ||.|:..:..| || .::
Mouse   234 YWCYITELPPRFPRHHIIMYEAIVTEGNEALVH---HMEVFQCA---AESEDFPQFNG-PC-DSK 290

  Fly   362 SIP---LACNAIVASWSRGSEGFTYPHEAGYPIESRQAKYYL-METHYNNLKPDFAQLHARQMAD 422
            ..|   ..|..::|:|:.|::.|.||.|||.|.....:..:| :|.||:|.:    ::..||  |
Mouse   291 MKPDRLNYCRHVLAAWALGAKAFYYPKEAGVPFGGPGSSPFLRLEVHYHNPR----KIQGRQ--D 349

  Fly   423 NSGLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQCIEDCTGYAFPQQGINIFAVM 487
            :||:::::|..||..|||.:.:|:.......|||.:...|..|.|.:.||..|....||:|||..
Mouse   350 SSGIRLHYTATLRRYDAGIMELGLVYTPLMAIPPQETAFVLTGYCTDKCTQMALQDSGIHIFASQ 414

  Fly   488 MRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDRLIAECIYDSSSRKA 552
            :.||..|::|.....|..:|...:..|::....:|:.|.|.:.|...|||.||..|.|::.::..
Mouse   415 LHTHLTGRKVVTVLARDGQERKVVNRDNHYSPHFQEIRMLKKVVTVYPGDVLITSCTYNTENKTL 479

  Fly   553 ITLGGLTMKEESCTVLTLYYPRQKKLTTCHS------LPSLPTVLHSLGIEQLAT---DSNPVLI 608
            .|:||..:.||.|.....||| |.:|..|.|      |.....:::....|::.|   .|.|...
Mouse   480 ATVGGFGILEEMCVNYVHYYP-QTELELCKSAVDDGFLQKYFHMVNRFSSEEVCTCPQASVPQQF 543

  Fly   609 SSPPELAGMTLEARLISYDWENQFGEFQEATRKG--SFKPICWGA-KNHVV--PGSEFLEGYSIN 668
            ||.|               |.:    |.....|.  .:.||.... |...|  ||...|:... .
Mouse   544 SSVP---------------WNS----FNRDMLKALYDYAPISMHCNKTSAVRFPGEWNLQPLP-K 588

  Fly   669 VTKTYKKHR-RCKPKRPLAPPTERTAP 694
            :|.|.::.. || |.|....|...|.|
Mouse   589 ITSTLEEPTPRC-PIRQTQSPANPTVP 614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 38/133 (29%)
Cu2_monooxygen 282..407 CDD:279429 38/131 (29%)
Cu2_monoox_C 438..583 CDD:281675 48/145 (33%)
DbhNP_620392.2 DOMON 61..176 CDD:281361 38/132 (29%)
Cu2_monooxygen 217..344 CDD:279429 39/140 (28%)
Cu2_monoox_C 365..520 CDD:281675 50/156 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.