DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and LOC105945848

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_012810196.1 Gene:LOC105945848 ID: Length:552 Species:Xenopus tropicalis

Alignment Length:557 Identity:150/558 (27%)
Similarity:241/558 (43%) Gaps:83/558 (15%)


  Fly   117 DDFRILWQI--INQDITFEIQARTLGYVGFGFSPDGNLAGADMAI-GWVDKGQT-YFQDRHVTRN 177
            |...:.|.:  ..:.|..|:|.....:|....:.:.||.|:|:.| ||  .|.| .|.|.|:  :
 Frog    35 DSALLRWGVDRHREQIALEVQVPRASWVALALNLERNLTGSDVVIGGW--NGDTEIFYDAHI--D 95

  Fly   178 GDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDP-SHDIAITNDTMRLLYMYHAQDPPHGS 241
            ....||.|.||||.|:....|.||:.||..||..|||| .:|.   .|....:..|..:.|   .
 Frog    96 SQWPPVRDNSQDYELLELRRNETHSTLRVWRKWFTCDPQDYDF---EDCTTYVTAYFGESP---D 154

  Fly   242 VRPGTLPDPARAFRPYRPMVLMQ-RAQLPMPSPTHDERVRVLELRNEDVELPAGDLPLFWCKMFK 305
            :|.|.    ..||.  :.:..|: ::::.:||     .:...:::.:|..:|..| ..:.|....
 Frog   155 LRDGA----ENAFS--KSIYFMEIKSEVQLPS-----ELLYYDIKRDDFLIPEED-TTYACSFIP 207

  Fly   306 LEDINRKHHLIRYEPIYDSSSS--VHYLQHITLHECQGAHAELEEMAREQGRPCLGARSIPLACN 368
            |..:..|||:::||...|..|.  ||   ||.::.|. |:||:   ..|.| .|.|:......|.
 Frog   208 LPQVATKHHIVKYEVNIDPQSDGIVH---HILIYACD-ANAEI---VPEVG-DCYGSDIRYSQCL 264

  Fly   369 AIVASWSRGSEGFTYPHEAGYPIESR-QAKYYLMETHYNNLKPDFAQLHARQMADNSGLKIYFTH 432
            .::..|:.|.|.|.||..||..|.:: ..:|..:|.||:|    |..:..  :.||||:::::|.
 Frog   265 NVMFGWAVGGEDFFYPEIAGVSIGTKYDPQYVRLEIHYSN----FDGISG--IRDNSGIRVFYTP 323

  Fly   433 VLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQC--------IEDCTGYAFPQQGINIFAVMMR 489
            .||..|||.|..|:.......||||.:...|.|.|        :::.||      .:..:|.::.
 Frog   324 ELRQLDAGILMAGVLTFPIQFIPPGAEAFRSYGLCDTGMIPQSLDEPTG------DLTAYAFLLH 382

  Fly   490 THQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDRLIAECIYDSSSRKAIT 554
            .|.....::|...|....:..:..|.:.|..:|..|..|:.:....||:::.||...:..|.::|
 Frog   383 AHLTAHGIRLLHYRNGTHIGSLGEDKSYDFGFQQIRYFPKPIDIKMGDQIVVECTGSTMDRDSVT 447

  Fly   555 LGGLTMKEESCTVLTLYYPRQKKLTTCHSLPSLPTVLHSLGIEQLATDSNPVLISSPPELAGMTL 619
            .||.:...|.|.....||| ...:.||.|...|..|..:||:|              ||.:.|..
 Frog   448 YGGPSSLNEMCLGFLFYYP-NIPIATCWSFYDLNHVTDALGLE--------------PEESVMDA 497

  Fly   620 EARLISYDWENQFGEFQEATRKGSFKPICWGAKNHVV 656
            ...:.:.||:::       ||..:.:.|.  ..||.|
 Frog   498 IFSMDTVDWDDE-------TRAKAQRAIM--ESNHTV 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 41/131 (31%)
Cu2_monooxygen 282..407 CDD:279429 38/128 (30%)
Cu2_monoox_C 438..583 CDD:281675 38/153 (25%)
LOC105945848XP_012810196.1 DOMON_DOH 39..155 CDD:187689 40/126 (32%)
Cu2_monooxygen 184..308 CDD:279429 40/137 (29%)
Cu2_monoox_C 329..475 CDD:281675 38/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.