DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and moxd1

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_002936361.2 Gene:moxd1 XenbaseID:XB-GENE-988179 Length:610 Species:Xenopus tropicalis

Alignment Length:539 Identity:180/540 (33%)
Similarity:290/540 (54%) Gaps:43/540 (8%)


  Fly   109 WDHA--IDLNDDFRILWQIINQDITFEIQARTLGYVGFGFSPDGNLAGADMAIGWVDKGQTYFQD 171
            :.|:  :|....:.:.|:...:.|||.:|..|||||||||||:|::|.:|:.||.|::|:.|.||
 Frog    22 YSHSAVLDGQGKYMLHWRHHGKSITFLLQVETLGYVGFGFSPNGDMASSDIVIGGVEEGKPYLQD 86

  Fly   172 RHVTRNGDPEPVV--DPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTMRLLYMYHA 234
            .:    .|...::  ||.|:|:|....||:|||:|:|.|.|.|||| :|..||..|:|:::.||.
 Frog    87 FY----SDGNRILHRDPHQNYLLEYAMENSTHTILKFSRDLHTCDP-NDKTITESTIRVIWAYHN 146

  Fly   235 QDPPHGSVRPGTLPDPARAFRPYRPMVLMQRAQLPMPSPTHDERVRV--LELRNEDVELPAGDLP 297
            .|..|  |.| |.....|..:..|         |..|..|:.:.|..  ....|::|.:|..| .
 Frog   147 DDIGH--VGP-TYHGLNRGRKSLR---------LLNPEKTYIKSVDTPSFNFTNKNVPIPYKD-T 198

  Fly   298 LFWCKMFKLEDINRKHHLIRYEPIYDSSSSVHYLQHITLHECQGAHAELEEMAREQGRPCL--GA 360
            .:||:|||:..:|:|||:::.||:..|.:. :.:.||.|:||.   ..:.:...:.|..|.  ..
 Frog   199 TYWCQMFKMPALNKKHHVVKIEPLIQSGNE-NLVHHILLYECD---RNVNDSVLDYGHECYHPNM 259

  Fly   361 RSIPLACNAIVASWSRGSEGFTYPHEAGYPI-ESRQAKYYLMETHYNNLKPDFAQLHARQMADNS 424
            ..:...|..:|.:|:.|.||||:|..||..: .....||.|||.||:|  |.    ....:.|||
 Frog   260 PDVFHTCETVVFAWAIGGEGFTFPSHAGLSLGMPTDPKYVLMEIHYDN--PS----QQEGLTDNS 318

  Fly   425 GLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQCIEDCTGYAFP---QQGINIFAV 486
            |:::|:||.:|..|||.|..|:..:..|:|||...:.:|||.|..:|...|..   .:||::|||
 Frog   319 GIRLYYTHHVRKYDAGVLETGIWVSLYHMIPPRMAQFISEGHCTMECLEEALSAENPEGIHVFAV 383

  Fly   487 MMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDRLIAECIYDSSSRK 551
            ::.:|..||.:..|..|:.||..|:|:|:..|..:|:|:.|.:....:|||.::.:|.|::..|.
 Frog   384 LLHSHLAGKAIWARHYRKGEEQKPLAYDTEYDFNFQEFKYLEEERTILPGDNIVTQCQYNTKGRT 448

  Fly   552 AITLGGLTMKEESCTVLTLYYPRQKKLTTCHSLPSLPTVLHSLGIEQL--ATDSNPVLISSPPEL 614
            .:|.|||:.::|.|....||||: ..|..|.|:|.:...|..:|::::  ...|.|.:|.||.:.
 Frog   449 TMTWGGLSTRDEMCLSFLLYYPK-INLARCESIPEIKQQLEFIGVKEIYRPVTSWPFIIKSPKKY 512

  Fly   615 AGMTLEARLISYDWENQFG 633
            ..::....:.:|.|..:.|
 Frog   513 NNLSFTEAMNAYQWSKKKG 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 57/136 (42%)
Cu2_monooxygen 282..407 CDD:279429 41/128 (32%)
Cu2_monoox_C 438..583 CDD:281675 52/148 (35%)
moxd1XP_002936361.2 DOMON_DOH 28..162 CDD:187689 59/142 (42%)
Cu2_monooxygen 183..311 CDD:279429 43/139 (31%)
Cu2_monoox_C 332..479 CDD:281675 52/148 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24391482
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H22904
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 1 1.000 FOG0005662
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.