DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: olf413 and dbh

Sequence 1:NP_001262204.1 Gene:olf413 FlyBaseID:FBgn0037153 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_002942324.2 Gene:dbh XenbaseID:XB-GENE-959495 Length:615 Species:Xenopus tropicalis

Alignment Length:616 Identity:167/617 (27%)
Similarity:270/617 (44%) Gaps:102/617 (17%)


  Fly   113 IDLNDDFRILWQIINQD--ITFEIQARTLGY-VGFGFSPDGNLAGADMAIGWVDKGQTYFQDRHV 174
            :|.....::.|.:...:  :.|.|..:.|.: :.||.|..|:...||||:.|.::..::|.|...
 Frog    53 LDPQGSLQLYWNVSYSEKVVYFRILIKDLKFGLIFGMSDRGDFEDADMAVLWTNELGSFFGDAWS 117

  Fly   175 TRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDPSHDIAITNDTMRLLYMYHAQDPPH 239
            .:.|...  :|..|||.|:...::.....|.|||...||||. |..|.:.|:.|:|         
 Frog   118 DQKGQLH--MDSQQDYELLNAQQSQEGLYLLFRRPFATCDPK-DYLIEDGTVHLIY--------- 170

  Fly   240 GSVRPGTLPDPARAFRPYRPMVL----------MQRAQL---PMPSPTHDERVRVLELRNEDVEL 291
                       |...:|:..:..          :||.||   .:|.|.....|..:|:|...|.:
 Frog   171 -----------ALLEKPFSTLSSIDVSAIKNRGLQRVQLLKPDLPIPRLPADVLNMEVRAPQVLI 224

  Fly   292 PAGDLPLFWCKMFKLEDINRKHHLIRYEPIYDS--SSSVHYLQHITLHECQGAHAELEEMAREQG 354
            ||.: ..:||.:.:|.....|||::.|||:...  .:.||   ||.:.:|...:..:   .|..|
 Frog   225 PAKE-TTYWCHITELPKDFTKHHIVMYEPVITKGHEAIVH---HIEVFQCASNYYTI---PRYDG 282

  Fly   355 RPC---LGARSIPLACNAIVASWSRGSEGFTYPHEAGYPIESRQAKYYL-METHYNNLKPDFAQL 415
             ||   :..:|:. :|..::|:|:.|::.|.||.|:|.......:..|| :|.||:|      .|
 Frog   283 -PCDSKMKPQSLN-SCRHVLAAWAMGAKAFYYPEESGLAFGGPDSSRYLRLEVHYHN------PL 339

  Fly   416 HARQMADNSGLKIYFTHVLRPNDAGTLSIGMDPNWRHIIPPGQKRVVSEGQCIEDCTGYAFPQQG 480
            ..:.:.|:||:::|:|..||..|||.:.:|:..:....||||||..:..|.|.:.||..|.|..|
 Frog   340 ELKGLRDSSGIRLYYTSTLRRYDAGIMEVGLVYSPVMAIPPGQKDFLLTGYCTDKCTDRALPSNG 404

  Fly   481 INIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSMPGDRLIAECIY 545
            |.|||..:.||..|:.|....:|:.:|...:..|.:....:|:.|.|.::||.:|||.::..|.|
 Frog   405 IKIFASQLHTHLGGRGVPPILVREGKEAEVVNADGHYSPHFQEIRMLKKAVHVLPGDVMVTSCSY 469

  Fly   546 DSSSRKAITLGGLTMKEESCTVLTLYYPRQKKLTTCHSLPS---LPTVLHSLGIEQLATDSNPVL 607
            ::..||.||:||.::.:|.|.....|||| ..|..|.|:..   |....|.  :.:..:|.    
 Frog   470 NTEDRKNITVGGFSITDEMCVNYVHYYPR-TDLELCKSMVDPGYLQKYFHM--VNRFNSDD---- 527

  Fly   608 ISSPPELAGMTLEARLISYDWENQFGEFQEATRKG--SFKPI---CWGAKNHVVPGSEFLEGYSI 667
            :|:.|   ..|:..:.....|.:    |.....|.  ||.||   |..:.....||.        
 Frog   528 VSTSP---NTTVTKQFQEVPWNS----FSAGVLKSLYSFAPISMHCNRSSAVRFPGE-------- 577

  Fly   668 NVTKTYKKHRRCKPKRPLAPPTERTAPPPAS 698
                        ..|:||....|:...|||:
 Frog   578 ------------WEKQPLPQINEKLPSPPAT 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
olf413NP_001262204.1 DOMON_DOH 111..243 CDD:187689 35/133 (26%)
Cu2_monooxygen 282..407 CDD:279429 38/131 (29%)
Cu2_monoox_C 438..583 CDD:281675 52/145 (36%)
dbhXP_002942324.2 DOMON 57..171 CDD:281361 34/137 (25%)
Cu2_monooxygen 214..341 CDD:279429 40/142 (28%)
Cu2_monoox_C 362..517 CDD:281675 54/156 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3568
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1472750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.