DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and YDJ1

DIOPT Version :10

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_014335.1 Gene:YDJ1 / 855661 SGDID:S000005008 Length:409 Species:Saccharomyces cerevisiae


Alignment Length:60 Identity:28/60 - (46%)
Similarity:43/60 - (71%) Gaps:2/60 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKN--EDGAKEFLRINEAHRVLIDHQRRALYD 66
            |.:||:|..|||.|||.|:|:.:|:||||||  |:.|::|...:.|:.:|.|.::|.:||
Yeast     8 YDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYD 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 26/58 (45%)
YDJ1NP_014335.1 PTZ00037 2..409 CDD:240236 28/60 (47%)

Return to query results.
Submit another query.