DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and SCJ1

DIOPT Version :10

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_013941.2 Gene:SCJ1 / 855254 SGDID:S000004827 Length:377 Species:Saccharomyces cerevisiae


Alignment Length:64 Identity:27/64 - (42%)
Similarity:47/64 - (73%) Gaps:3/64 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKN---EDGAKEFLRINEAHRVLIDHQRRALYD 66
            :|:|.:|.:.::||:.|||.|:|:||.:||||||   |:..::|:.:.||:.||.|.:::.:||
Yeast    22 QDYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIYD 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 25/61 (41%)
SCJ1NP_013941.2 DnaJ_bact 23..370 CDD:274090 27/63 (43%)

Return to query results.
Submit another query.