DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and XDJ1

DIOPT Version :10

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_013191.1 Gene:XDJ1 / 850779 SGDID:S000004080 Length:459 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:30/71 - (42%)
Similarity:45/71 - (63%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDVYEDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNED-GAKE-----FLRINEAHRVLIDHQ 60
            ||..:..|.|||:.|:||..|||.|:|:|:|::||||..| .:||     |..|..|:.:|.|.:
Yeast     4 SDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68

  Fly    61 RRALYD 66
            :::.||
Yeast    69 KKSHYD 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 26/64 (41%)
XDJ1NP_013191.1 PTZ00037 8..412 CDD:240236 28/67 (42%)

Return to query results.
Submit another query.