DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and Dnaja2

DIOPT Version :10

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_114468.2 Gene:Dnaja2 / 84026 RGDID:71001 Length:412 Species:Rattus norvegicus


Alignment Length:58 Identity:25/58 - (43%)
Similarity:42/58 - (72%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINEAHRVLIDHQRRALYD 66
            |.:||:|..|:::|:|.|:|:|:.:||||||.:...:|..|:.|:.||.:.::|.|||
  Rat    10 YDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYD 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 23/56 (41%)
Dnaja2NP_114468.2 PTZ00037 4..412 CDD:240236 25/58 (43%)
CXXCXGXG motif 143..150
CXXCXGXG motif 159..166
CXXCXGXG motif 186..193
CXXCXGXG motif 202..209
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.