DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and J2

DIOPT Version :10

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_568412.1 Gene:J2 / 832267 AraportID:AT5G22060 Length:419 Species:Arabidopsis thaliana


Alignment Length:58 Identity:21/58 - (36%)
Similarity:39/58 - (67%) Gaps:1/58 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINEAHRVLIDHQRRALYD 66
            |::||:|:.|...::|.|:::.:::.||||..|..| |..:.:|:.||.|.::|.:||
plant    16 YEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEK-FKELAQAYEVLSDPEKREIYD 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 19/56 (34%)
J2NP_568412.1 PTZ00037 7..419 CDD:240236 21/58 (36%)

Return to query results.
Submit another query.