DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and DNAJA4

DIOPT Version :10

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_047288792.1 Gene:DNAJA4 / 55466 HGNCID:14885 Length:444 Species:Homo sapiens


Alignment Length:77 Identity:29/77 - (37%)
Similarity:44/77 - (57%) Gaps:18/77 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNED-GAK-----------------EFLRINEAHR 54
            :|.:||:..:|:..|||.|:|:|:|:||||||.| |.|                 .|..|::|:.
Human    36 YYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKGHGHLQPDISLYSYSGFSFKLISQAYE 100

  Fly    55 VLIDHQRRALYD 66
            ||.|.::|.:||
Human   101 VLSDPKKRDVYD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 27/75 (36%)
DNAJA4XP_047288792.1 PTZ00037 15..441 CDD:240236 29/77 (38%)

Return to query results.
Submit another query.