DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7133 and CG5001

Sequence 1:NP_649379.1 Gene:CG7133 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster

Alignment Length:63 Identity:31/64 (48%)
Similarity:47/64 (73%) Gaps:2/64 (3%)


  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNE--DGAKEFLRINEAHRVLIDHQRRALYD 66
            :|:|::||||:.|||.|||.|:|:|:|:||||||:  :...:|..:.||:.||.|..:|.:||
  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 30/61 (49%)
DnaJ 7..>66 CDD:223560 30/61 (49%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 31/64 (48%)
DnaJ 4..65 CDD:278647 30/61 (49%)
DnaJ_C 174..338 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.