DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and dnaja1

DIOPT Version :10

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_955956.1 Gene:dnaja1 / 323922 ZFINID:ZDB-GENE-030131-2642 Length:398 Species:Danio rerio


Alignment Length:58 Identity:25/58 - (43%)
Similarity:43/58 - (74%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINEAHRVLIDHQRRALYD 66
            |.:||:..:|:..|:|.|:|:|:|:||||||....::|.:|::|:.||.|.::|.:||
Zfish     8 YDMLGVKPSASPEELKKAYRKLALKYHPDKNPTEGEKFKQISQAYEVLSDAKKREVYD 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 23/56 (41%)
dnaja1NP_955956.1 PTZ00037 2..395 CDD:240236 25/58 (43%)

Return to query results.
Submit another query.