DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and dnj-18

DIOPT Version :10

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_497962.1 Gene:dnj-18 / 175616 WormBaseID:WBGene00001036 Length:249 Species:Caenorhabditis elegans


Alignment Length:65 Identity:27/65 - (41%)
Similarity:43/65 - (66%) Gaps:4/65 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKN----EDGAKEFLRINEAHRVLIDHQRRALYD 66
            :|||:||||.::|:..:||.|:.:||.|:|||.|    |:.||:|.::..|:.:|....:|..||
 Worm    23 QDHYKVLGLAQSASQKDIKSAYYKLSKQHHPDTNPTNKEEAAKKFHQVAMAYEILSSEDKRKAYD 87

  Fly    67  66
             Worm    88  87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 25/62 (40%)
dnj-18NP_497962.1 PRK14300 23..>181 CDD:172788 27/65 (42%)
DnaJ 24..87 CDD:395170 25/62 (40%)

Return to query results.
Submit another query.