DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and dnj-12

DIOPT Version :10

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_493570.1 Gene:dnj-12 / 173341 WormBaseID:WBGene00001030 Length:402 Species:Caenorhabditis elegans


Alignment Length:59 Identity:28/59 - (47%)
Similarity:49/59 - (83%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINEAHRVLIDHQRRALYD 66
            :|.|||:..:|:|:|:|.|:|:::|::|||||.|||::|.:|::|:.||.|.::|.:||
 Worm     7 YYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKKRQIYD 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 26/57 (46%)
dnj-12NP_493570.1 PTZ00037 2..401 CDD:240236 28/59 (47%)

Return to query results.
Submit another query.