DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act79B and LOC1275975

DIOPT Version :10

Sequence 1:NP_524210.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_061497104.1 Gene:LOC1275975 / 1275975 VectorBaseID:AGAMI1_009754 Length:376 Species:Anopheles gambiae


Alignment Length:97 Identity:21/97 - (21%)
Similarity:30/97 - (30%) Gaps:50/97 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HFKRLSGKELPIRSVQADDVFW----LHSC-----------------FGFSDIRHHVINETTDLN 61
            :|:|||              ||    .|:|                 .||...:..|:|..    
Mosquito   246 YFRRLS--------------FWACVLTHACEMNCFFVLLSWLPTYFHDGFPHAKGWVVNMI---- 292

  Fly    62 ELVEKEPWLSSEKLVVKPDMLFGKRGKSGLVA 93
                  |||:     :.|..||.|...:.|:|
Mosquito   293 ------PWLA-----LPPCTLFAKYLTTRLLA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act79BNP_524210.1 ASKHA_NBD_actin 7..371 CDD:466823 21/97 (22%)
LOC1275975XP_061497104.1 None

Return to query results.
Submit another query.