DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: P5CDh1 and P5CDh2

Sequence 1:NP_001189159.1 Gene:P5CDh1 FlyBaseID:FBgn0037138 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_788705.1 Gene:P5CDh2 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster

Alignment Length:537 Identity:279/538 (52%)
Similarity:375/538 (70%) Gaps:4/538 (1%)


  Fly    38 DFPIANEPILGYLKDSKERKALEQALKGTASSCEDIPIVIGGKEYKTPEVRYQVMPHDHQHKLAS 102
            |..:|||.:|.|.:.||||..||.||.|..:..|.:||||.|:|::..|...||:|:|.|..:|.
  Fly    47 DEMVANEKLLQYDEGSKERTELETALLGVLNRVEHVPIVINGQEFQAKEDFQQVLPYDIQQPIAH 111

  Fly   103 FYYADKKLIEKAIKTAVETQPKWDRVSIADRLKIWEKAADLMATTYRQDLNAATMLGQSKTAIQA 167
            :.:|.:.||:.||..:||.|.|||:|.::||:.|||:||.|:|..||.::.|||||||.||..||
  Fly   112 YGHAHRVLIQMAIDKSVEAQVKWDKVRLSDRIDIWERAAMLIAGRYRYNIIAATMLGQGKTLRQA 176

  Fly   168 EIDSAAELIDFIRMNAYFLKEVTKYQPISENIKVTKNSLRYRGIDGFIAAVSPFNFTAIGGNLSY 232
            |:| .|||:||:|:|..||:|:..|:||.:.....:||:|.||:.||:||:||||||.|..||:|
  Fly   177 EMD-VAELVDFMRINPVFLRELANYEPIRDIQNNCRNSMRLRGLSGFVAAISPFNFTGIAANLAY 240

  Fly   233 TPALMGNGVLWKPSDTAMLSNWIIFKIMREAGVPDGVVNFVPADGPVFGDTITASPHLAGINFTG 297
            |||||||.|:|||||:|:|||:.:||.:|||||||||||||||:...|...:|..|.||||||||
  Fly   241 TPALMGNSVIWKPSDSAILSNYFVFKALREAGVPDGVVNFVPAEETTFASVVTQHPKLAGINFTG 305

  Fly   298 SVPTFNRLWKQVGNNIDNYVNFPRLTGECGGKNFHFIHASADVESVVTSTIRSAFEYCGQKCSAC 362
            :......||:.|..||:.|.|:|||.||.|||||||:|:||:.|:.|..|||:||||.|||||:|
  Fly   306 TSTVLKVLWQLVAQNINFYQNYPRLVGEGGGKNFHFVHSSAEPETAVACTIRAAFEYAGQKCSSC 370

  Fly   363 SRMYVPESLWP-QIKEGLVCEAAKLKI-GDVQDFSSFTSAVIDDKAFKRITGYIEHAKKSPNLEI 425
            |.:|||||||. .|:|.|:...|.|.: .|.....||.||||:.:|:.||..::.:..:||:.:|
  Fly   371 SMLYVPESLWQNHIREPLLEITASLVVRQDATYCDSFCSAVINRRAYDRIYMWLRYIDQSPSCQI 435

  Fly   426 LAGGTYSDSKGYFVNPTIVLSKDPKDRIMTEEIFGPVLSIYVYKESDLLETMKLVHTSTKFALTG 490
            |.||:....:||:|:||:||.||..:.|..||:..|:|.:|||.:..|.|||:.| ......|||
  Fly   436 LVGGSCDKRRGYYVDPTVVLVKDLDNIICREELLAPILGVYVYPDHKLKETMEKV-AQINHGLTG 499

  Fly   491 AVFGQDEDFVKCALQEFKMAAGNFYINDKSTGSVVGQQPFGGGRMSGTNDKAGGPHYILRWTSPQ 555
            :||.||::|::.|...|::..||..:||||||.:|||||||.|.|:||:||.|.||.:|||||||
  Fly   500 SVFAQDQNFIEEAYDAFRVNVGNLNVNDKSTGLMVGQQPFGAGHMTGTSDKLGTPHSLLRWTSPQ 564

  Fly   556 SIKETFVPLRDVNYPYM 572
            .|||::...|::.||||
  Fly   565 VIKESYKTHRNIFYPYM 581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
P5CDh1NP_001189159.1 ALDH_F4-17_P5CDH 41..563 CDD:143441 273/524 (52%)
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 273/522 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C151330408
eggNOG 1 0.900 E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S619
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003397
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42862
RoundUp 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.