DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and CCNK

DIOPT Version :10

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001092872.1 Gene:CCNK / 8812 HGNCID:1596 Length:580 Species:Homo sapiens


Alignment Length:189 Identity:46/189 - (24%)
Similarity:81/189 - (42%) Gaps:30/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LTSAEERLLLKQYEIYLFDFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEIL-ATCVFV 111
            |..|.|....::...::||...|.  .:....:.|...||.|||:.:|...: |:.:. |.|:|:
Human    41 LDPATEARYRREGARFIFDVGTRL--GLHYDTLATGIIYFHRFYMFHSFKQF-PRYVTGACCLFL 102

  Fly   112 ACKVEEF----------------NVSINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNP 160
            |.||||.                :|...||     ||..|...:||  |.:|:..:.:.|.:.:|
Human   103 AGKVEETPKKCKDIIKTARSLLNDVQFGQF-----GDDPKEEVMVL--ERILLQTIKFDLQVEHP 160

  Fly   161 FRPIEGFLIDIKTRSNMQNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASR 219
            ::.:..:...:|...|  ...:|.....:|::.:..:...|...|..||: ||::.|.|
Human   161 YQFLLKYAKQLKGDKN--KIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAV-AVMYLAGR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 46/189 (24%)
CCNKNP_001092872.1 CYCLIN_CCNK_rpt1 40..154 CDD:410233 32/122 (26%)
CYCLIN_CCNK_rpt2 158..258 CDD:410234 13/62 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..580
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.