DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and RCY1

DIOPT Version :10

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_565622.1 Gene:RCY1 / 817183 AraportID:AT2G26430 Length:416 Species:Arabidopsis thaliana


Alignment Length:253 Identity:44/253 - (17%)
Similarity:75/253 - (29%) Gaps:95/253 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 EQQQHTTNATQTASTAENNENGDLSIGPILPGHPLQRRQSP--PSEQQPSTLLYPFVTNGSIELQ 186
            |:|:...:..|.......::|       |:..:.....|:|  ||..:...:...|:|..::: .
plant    12 EKQKGIQSEVQVLEMVSGHKN-------IVDFYGAYYHQAPRTPSLPEGLWIATEFITGATLQ-D 68

  Fly   187 LLPSRNCADETSLS-----------------------------------LSIGTMDQKTMSEVEK 216
            |:.:|....|..:|                                   :.||.....|..  ||
plant    69 LIGTRKTLGERWISYICKQITTGLFHLQKKNIIHHDIKPENILITSYGEVKIGEFGFATFG--EK 131

  Fly   217 KSYEKGETSLEREE--ARRETKRQIE---------IAELEFAEAKRIRQHARAELHKAHLFREEA 270
            .|...|..:....|  |....|.:.:         ||.:|.||.          |..:.|.|::.
plant   132 SSSTSGTITYSAPEVLANFTNKHEYDHKADIWSLGIAAIEMAEG----------LSFSKLPRQKL 186

  Fly   271 SRRISA-------TMMQITCHNCKQHFQAPAALV--------------------PPPP 301
            ..:|:.       ||.::...:...||:.||...                    ||||
plant   187 IEKITTWSRANINTMGKMERTSSVLHFRVPAERTIERPSARQLLSHPFIGEIREPPPP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 44/253 (17%)
RCY1NP_565622.1 CYCLIN_AcCycL_rpt1 21..148 CDD:410294 21/136 (15%)
CYCLIN_AcCycL_rpt2 150..250 CDD:410297 20/105 (19%)
SF-CC1 336..>414 CDD:273721
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.