DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eg and Esrrg

DIOPT Version :10

Sequence 1:NP_524206.1 Gene:eg / 40428 FlyBaseID:FBgn0000560 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_036065.1 Gene:Esrrg / 26381 MGIID:1347056 Length:458 Species:Mus musculus


Alignment Length:79 Identity:38/79 - (48%)
Similarity:49/79 - (62%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLCKVCGEPAAGFHFGAFTCEGCKSFFGRT-YNNIAAIAGCKHNGDCVINKKNRTACKACRLRKC 66
            :||.|||:.|:|:|:|..:||.||:||.|| ..||.  ..|....:|.|.|:.|.:|:|||..||
Mouse   126 RLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIE--YSCPATNECEITKRRRKSCQACRFMKC 188

  Fly    67 LLVGMSKSGSRYGR 80
            |.|||.|.|.|..|
Mouse   189 LKVGMLKEGVRLDR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egNP_524206.1 NR_DBD_like 3..87 CDD:413390 38/79 (48%)
EsrrgNP_036065.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..85
NR_DBD_ERR 122..218 CDD:143544 38/79 (48%)
NR_LBD_ERR 237..456 CDD:132744
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.