DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eg and Ar

DIOPT Version :10

Sequence 1:NP_524206.1 Gene:eg / 40428 FlyBaseID:FBgn0000560 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_036634.2 Gene:Ar / 24208 RGDID:2147 Length:902 Species:Rattus norvegicus


Alignment Length:109 Identity:41/109 - (37%)
Similarity:51/109 - (46%) Gaps:22/109 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAG-----CKHNGDCVINKKNRTACKACRLR 64
            |.:||:.|:|.|:||.||..||.||.|      |..|     |....||.|:|..|..|.:||||
  Rat   542 CLICGDEASGCHYGALTCGSCKVFFKR------AAEGKQKYLCASRNDCTIDKFRRKNCPSCRLR 600

  Fly    65 KCLLVGMSKSGSRYGRRSNWFKIHCLLQEQQTTSGLGGGSSVGS 108
            ||...||:....:..:..|     ..|||:      |..||.||
  Rat   601 KCYEAGMTLGARKLKKLGN-----LKLQEE------GENSSAGS 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egNP_524206.1 NR_DBD_like 3..87 CDD:413390 33/86 (38%)
ArNP_036634.2 Interaction with ZNF318. /evidence=ECO:0000250|UniProtKB:P19091 1..569 15/32 (47%)
Modulating 1..540
Androgen_recep 6..443 CDD:426632
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..146
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..224
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..465
Interaction with LPXN. /evidence=ECO:0000250|UniProtKB:P10275 534..901 41/109 (38%)
NR_DBD_AR 537..618 CDD:143547 32/81 (40%)
Interaction with HIPK3. /evidence=ECO:0000269|PubMed:9725910 554..644 35/97 (36%)
Interaction with CCAR1. /evidence=ECO:0000250|UniProtKB:P10275 574..901 24/71 (34%)
Interaction with KAT7. /evidence=ECO:0000250|UniProtKB:P10275 607..901 10/38 (26%)
NR_LBD_AR 655..900 CDD:132758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.