DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eg and nhr-99

DIOPT Version :10

Sequence 1:NP_524206.1 Gene:eg / 40428 FlyBaseID:FBgn0000560 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_503214.1 Gene:nhr-99 / 178569 WormBaseID:WBGene00003689 Length:418 Species:Caenorhabditis elegans


Alignment Length:68 Identity:28/68 - (41%)
Similarity:38/68 - (55%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCKHNGDCVINKKNRTACKACRLRKCLLV 69
            |::|.:|:.|.||||.||..|..|| |.:.....:..|:.|.:|...|.....||.|||:||..|
 Worm    26 CEICDKPSHGKHFGAVTCRACAMFF-RRFGRCKNMKPCEMNNNCQFPKNGYFNCKKCRLQKCWDV 89

  Fly    70 GMS 72
            ||:
 Worm    90 GMT 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egNP_524206.1 NR_DBD_like 3..87 CDD:413390 28/68 (41%)
nhr-99NP_503214.1 ZnF_C4 25..94 CDD:197701 28/68 (41%)
Hormone_recep 186..389 CDD:459675
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.