DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eg and pgr

DIOPT Version :10

Sequence 1:NP_524206.1 Gene:eg / 40428 FlyBaseID:FBgn0000560 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_002935617.1 Gene:pgr / 100493487 XenbaseID:XB-GENE-484457 Length:731 Species:Xenopus tropicalis


Alignment Length:97 Identity:35/97 - (36%)
Similarity:50/97 - (51%) Gaps:14/97 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLCKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAG-----CKHNGDCVINKKNRTACKACR 62
            ::|.:||:.|:|.|:|..||..||.||.|      |:.|     |....||:::|..|..|.:||
 Frog   362 KVCLICGDEASGCHYGVLTCGSCKVFFKR------AVEGQHNYLCAGRNDCIVDKIRRKNCPSCR 420

  Fly    63 LRKCLLVGMSKSG---SRYGRRSNWFKIHCLL 91
            ||||...||...|   .::||.....:|..|:
 Frog   421 LRKCCQAGMVLGGRKFKKFGRIKTGREIDALV 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egNP_524206.1 NR_DBD_like 3..87 CDD:413390 33/91 (36%)
pgrXP_002935617.1 Prog_receptor <171..361 CDD:460470
NR_DBD_GR_PR 361..437 CDD:143546 31/80 (39%)
NR_LBD_PR 484..731 CDD:132759
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.