DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and spring1

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001016016.1 Gene:spring1 / 548770 XenbaseID:XB-GENE-5956985 Length:204 Species:Xenopus tropicalis


Alignment Length:131 Identity:29/131 - (22%)
Similarity:48/131 - (36%) Gaps:35/131 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 LVYWLRS------ETHRDMAAWARSLVQGSHQAVNYQREFSFRCLFQGR---QC------QLVVH 544
            |:|:|.|      .|.||     |:|:| :.|..|.|.:..|......|   ||      :|::.
 Frog    27 LIYFLTSTFKQEERTVRD-----RTLLQ-TDQDQNIQWKVQFNLGNSSRISNQCRNSVQGKLLIT 85

  Fly   545 INRGFFLYDCGGFAPTTPTVATAKTQLWQFAFDKLKGSADDGARMLYLDFGEDGEIELDMECCPK 609
            .:.|:........|.....:..|.|:|:     ..:....:|...:|         |..:.||.:
 Frog    86 DDMGYICERKELLANGCCNINVASTKLY-----SCETCLSNGCCSVY---------EYCVSCCLQ 136

  Fly   610 P 610
            |
 Frog   137 P 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492
PHsplit_syntrophin <293..351 CDD:269960
spring1NP_001016016.1 DUF2054 73..194 CDD:370892 14/79 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.