DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and Magix

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_061302.2 Gene:Magix / 54634 MGIID:1859644 Length:324 Species:Mus musculus


Alignment Length:156 Identity:41/156 - (26%)
Similarity:70/156 - (44%) Gaps:22/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 GLGISIKGGR--ENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSG 236
            |.|:::.|||  ....|:.:..:.:...|.:...|..||.:|.:||:..:..||.:.|..::..|
Mouse   137 GFGLTLSGGRNVSGDAPLTVHGLLKDGPAQRCGRLQAGDLVLYINGQSTQGLTHAQVVERIRTGG 201

  Fly   237 RVVDLEVKFLREVTPYFRKASIISEVGW--ELQRAFLCPLGPGVPT----SP----PAPKTTPRA 291
            ..:.|.::     .|.....|.|.|||.  :..|: |.|.|..|.:    ||    |..:|:||.
Mouse   202 PHLCLVLQ-----RPQDMDGSRIKEVGGHRKTDRS-LDPRGSRVESRSTISPVHHRPKTRTSPRP 260

  Fly   292 DTRYIPLQLTHLARNLKY--IDPENR 315
            ....:  .:.|:.|.:::  .|.|||
Mouse   261 SPEAV--AIGHVVRAVEHPTEDLENR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 18/71 (25%)
PHsplit_syntrophin <293..351 CDD:269960 6/25 (24%)
MagixNP_061302.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PDZ 126..211 CDD:214570 18/78 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..263 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.