DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and Patj

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_477342.1 Gene:Patj / 44100 FlyBaseID:FBgn0067864 Length:871 Species:Drosophila melanogaster


Alignment Length:135 Identity:47/135 - (34%)
Similarity:70/135 - (51%) Gaps:23/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 IKSDNNGLGISIKG---GRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAV 229
            :|.|.|||||:|.|   .:|....|.:..:..|.|||.:..:.|.|.|:.|:|:.|:..::.:||
  Fly   321 LKKDANGLGITIAGYVCEKEELSGIFVKSVSPGSAADLSGRIRVNDRIIEVDGQSLQGYSNHQAV 385

  Fly   230 RALKRSGRVVDLEV-KFLREVTPYFRKASIISEVGWELQRAF-----LCPLGPGVPTSPPAPKTT 288
            ..||:||:||:|.: ::||  .|.|.          :||:|.     |....||.|:..|.|  |
  Fly   386 ELLKKSGQVVNLRLERYLR--GPKFE----------QLQQAIAANDKLPSSAPGTPSRAPMP--T 436

  Fly   289 PRADT 293
            |.|.|
  Fly   437 PVATT 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 30/79 (38%)
PHsplit_syntrophin <293..351 CDD:269960 1/1 (100%)
PatjNP_477342.1 L27 12..70 CDD:295425
PDZ_signaling 154..226 CDD:238492
PDZ_signaling 318..400 CDD:238492 30/78 (38%)
PDZ_signaling 557..643 CDD:238492
PDZ_signaling 726..807 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.