DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and pdzk1

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001122142.2 Gene:pdzk1 / 337325 ZFINID:ZDB-GENE-031222-1 Length:553 Species:Danio rerio


Alignment Length:275 Identity:56/275 - (20%)
Similarity:93/275 - (33%) Gaps:86/275 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDESCEAAQPSNDGQSTTLNGTLGSNHSGGGGGG 91
            :||:.|:...||...:            ..:|:.:..|....|.|.|.||: .||..        
Zfish    46 AGLKDGDRILRVNNTF------------VDNLEHTQVADLVRNSGMSVTLH-VLGEE-------- 89

  Fly    92 AGGGGTGGGGQNGTLPNSASLQGMNIQDTELDGSASNDNGDRDPCLNNNNNAGDGGGMDMCDVPD 156
                          ...:|....:|:.|.:      :..|...|.:|..:...            
Zfish    90 --------------AYKTAKANNVNLADLQ------SLPGQSQPTMNGVSTPA------------ 122

  Fly   157 HVANQKRHVRIIKSDNNGLGISIKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELR 221
                .|..:..::..::|.|.|:| ..:....|.:..:..|..|||| |:.:||.::.:|.|.:.
Zfish   123 ----AKAKLCYLQKSSSGFGFSLK-STKGAHGIFMVDVVSGGVADQA-GVKLGDRLVEINSENVE 181

  Fly   222 DATHDEAVRALK-RSGRVVDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGV------- 278
            ...||:.|:.:| .|.|::.|.|.  .|...||:..:|                .|||       
Zfish   182 HLVHDQIVQKVKAASDRLMLLLVD--EEADRYFKSKNI----------------QPGVSHATVKH 228

  Fly   279 -PTSPPAPKTTPRAD 292
             |..|.......|||
Zfish   229 LPHKPRIADMIKRAD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622 4/30 (13%)
PDZ_signaling 163..244 CDD:238492 22/81 (27%)
PHsplit_syntrophin <293..351 CDD:269960 56/275 (20%)
pdzk1NP_001122142.2 PDZ_signaling 6..86 CDD:238492 12/52 (23%)
PDZ_signaling 126..204 CDD:238492 22/79 (28%)
PDZ 232..311 CDD:214570 4/12 (33%)
PDZ_signaling 392..471 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.