DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and AgaP_AGAP010776

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_318531.2 Gene:AgaP_AGAP010776 / 1278885 VectorBaseID:AGAP010776 Length:155 Species:Anopheles gambiae


Alignment Length:138 Identity:43/138 - (31%)
Similarity:59/138 - (42%) Gaps:20/138 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GTGGGGQNGTLPNSASLQGMNIQDTELDGSASNDNGDRDPCLNNNNNAGDGGGMDMCDVPDHVAN 160
            |.|.|...||.|.....|.|.....:.:||:...|.|:.|.:                ||||..|
Mosquito     1 GAGAGTLLGTDPGVRRHQSMQRLPLDQNGSSLEQNQDQPPHI----------------VPDHRGN 49

  Fly   161 QKRHVRIIKSDNNGLGISIKGGRENRMPI-LISKIFRGMAADQAKGLYVGDAILTVNGEELRDAT 224
              .|:.:.|| ...|||:|:||...:.|: .|..|....||..|.||.||..||.|:|.::....
Mosquito    50 --LHITVKKS-KPILGIAIEGGANTKHPLPRIINIHEHGAAYDAGGLEVGQLILEVDGNKVEGMH 111

  Fly   225 HDEAVRAL 232
            |.:..|.:
Mosquito   112 HQDVARLI 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 25/71 (35%)
PHsplit_syntrophin <293..351 CDD:269960
AgaP_AGAP010776XP_318531.2 PDZ_signaling 51..136 CDD:238492 25/70 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.