DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and adra2b

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_002932610.1 Gene:adra2b / 100485811 XenbaseID:XB-GENE-999343 Length:410 Species:Xenopus tropicalis


Alignment Length:126 Identity:28/126 - (22%)
Similarity:39/126 - (30%) Gaps:41/126 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 NALHSAMGTSTQRALAEANRALTNLIGELKHIG---WLSKRMSGGGSSGSAG----GGAASGGSG 400
            |:.|    |.||..:. :::..|.|..:..|.|   ..|.|....|.|.|.|    |......:|
 Frog   228 NSSH----TQTQCGII-SSQEKTGLALDDLHCGVPVLSSTREERNGHSESFGLQPQGENLKHTNG 287

  Fly   401 TSNSV------VAGELVSPSGRSSSESSDESDK-----------------------WLPIF 432
            ...:|      |.|.::.|.|...|:.|....|                       |.|.|
 Frog   288 CEPAVMDTVATVKGVMLMPKGAKDSDLSSAKKKSYINREKRFTFVLAVVIGVFVLCWFPFF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492
PHsplit_syntrophin <293..351 CDD:269960 2/7 (29%)
adra2bXP_002932610.1 7tm_4 20..>152 CDD:304433
7tm_1 29..386 CDD:278431 28/126 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.