DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11247 and ZNF461

Sequence 1:NP_001097659.1 Gene:CG11247 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_694989.2 Gene:ZNF461 HGNCID:21629 Length:563 Species:Homo sapiens

Alignment Length:318 Identity:107/319 (34%)
Similarity:159/319 (50%) Gaps:12/319 (4%)


  Fly    91 KHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQC 155
            |.:.|.:|.|.|...:.| :|:.||:.|:.::|.:|||::.....|..| ...|...|.:.|.:|
Human   244 KCNECKECWKAFVHCSQL-KHLRIHNGEKRYECNECGKAFNYGSELTLH-QRIHTGEKPYECKEC 306

  Fly   156 PKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTN 220
            .|:|..:.:|..|.|||:|||||.|..|.|.|.||.||.:|:..|  |..:.:.|.:|..:|...
Human   307 GKAFRQRSQLTQHQRLHTGEKPYECKQCGKAFIRGFQLTEHLRLH--TGEKPYECKECGKTFRHR 369

  Fly   221 ANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQ 285
            ::|.:|...|.....:.|..|...|:...:. :|..:.|.....:||..|.|.......|..|.:
Human   370 SHLTIHQRIHTGEKPYECRECGKAFSYHSSF-SHHQKIHSGKKPYECHECGKAFCDGLQLTLHQR 433

  Fly   286 RHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFR 350
            .||..|.:.|:.|...|.|.|....|.|:||||:|::|.||.:.|...|.|..|.|.||||||:.
Human   434 IHTGEKPYECKECGKTFRQCSHLKRHQRIHTGEKPHECMICGKAFRLHSHLIQHQRIHTGEKPYE 498

  Fly   351 CQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVELQSH-VEHCAKCPV 407
            |:.|..  |||..:...:| ::||..:|||.|...   |..:::|..| ..|..:.||
Human   499 CKECGK--AFSYHSSFSHH-QRIHSGKKPYQCGKA---FNHRLQLNLHQTLHTGEKPV 550

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 52/156 (33%)
C2H2 Zn finger 95..115 CDD:275368 7/20 (35%)
zf-H2C2_2 107..132 CDD:290200 9/25 (36%)
C2H2 Zn finger 123..144 CDD:275368 6/21 (29%)
C2H2 Zn finger 152..172 CDD:275368 8/20 (40%)
zf-H2C2_2 165..189 CDD:290200 14/24 (58%)
C2H2 Zn finger 180..200 CDD:275368 9/20 (45%)
COG5048 <192..369 CDD:227381 56/177 (32%)
C2H2 Zn finger 210..230 CDD:275370 5/20 (25%)
C2H2 Zn finger 238..260 CDD:275371 5/22 (23%)
C2H2 Zn finger 267..287 CDD:275368 5/20 (25%)
C2H2 Zn finger 295..315 CDD:275368 7/20 (35%)
zf-H2C2_2 309..332 CDD:290200 11/23 (48%)
C2H2 Zn finger 323..343 CDD:275368 8/20 (40%)
C2H2 Zn finger 351..374 CDD:275368 7/23 (30%)
C2H2 Zn finger 382..399 CDD:275368 4/18 (22%)
ZNF461NP_694989.2 KRAB 6..66 CDD:214630
C2H2 Zn finger 248..267 CDD:275368 7/20 (35%)
C2H2 Zn finger 275..295 CDD:275368 6/21 (29%)
zf-H2C2_2 287..312 CDD:316026 8/26 (31%)
C2H2 Zn finger 303..323 CDD:275368 8/20 (40%)
COG5048 <312..515 CDD:227381 72/208 (35%)
C2H2 Zn finger 331..351 CDD:275368 9/20 (45%)
C2H2 Zn finger 359..379 CDD:275368 5/20 (25%)
C2H2 Zn finger 387..407 CDD:275368 4/21 (19%)
C2H2 Zn finger 415..435 CDD:275368 5/20 (25%)
C2H2 Zn finger 443..463 CDD:275368 7/20 (35%)
C2H2 Zn finger 471..491 CDD:275368 8/20 (40%)
C2H2 Zn finger 499..519 CDD:275368 7/23 (30%)
C2H2 Zn finger 527..544 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.