DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11247 and ZNF45

Sequence 1:NP_001097659.1 Gene:CG11247 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_003416.1 Gene:ZNF45 HGNCID:13111 Length:682 Species:Homo sapiens

Alignment Length:456 Identity:129/457 (28%)
Similarity:195/457 (43%) Gaps:100/457 (22%)


  Fly    41 IKRRKSSLASLRDACVDEEEDD---------------------GGEQDSKDDDYVQP-------Q 77
            ||.:.|.:...|..|..|:.||                     .||:..|.:..|:.       |
Human   116 IKYQDSVVNIQRTGCQLEKRDDLHYKDEGFSNQSSHLQVHRVHTGEKPYKGEHCVKSFSWSSHLQ 180

  Fly    78 LKKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRH------------------------------- 111
            :.:.|..||    |.:.|.:|...|...:.||.|                               
Human   181 INQRAHAGE----KPYKCEKCDNAFRRFSSLQAHQRVHSRAKSYTNDASYRSFSQRSHLPHHQRV 241

  Fly   112 -------------------------MLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFV 151
                                     :::|:.|:|:||::||..:.|...|:.|: ..|..:|.:.
Human   242 PTGENPYKYEECGRNVGKSSHCQAPLIVHTGEKPYKCEECGVGFSQRSYLQVHL-KVHTGKKPYK 305

  Fly   152 CSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSAS 216
            |.:|.|||:.:.||:.|.|:|:|||||.|:.|.|.|:....|..|...|  |..:.:.|.:|...
Human   306 CEECGKSFSWRSRLQAHERIHTGEKPYKCNACGKSFSYSSHLNIHCRIH--TGEKPYKCEECGKG 368

  Fly   217 FSTNANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLA 281
            ||..::|:.|...|.....::|..|...|.....|..| .:.|.....::|:.|.|......|..
Human   369 FSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDH-QRGHTGEKPYQCDACGKGFSRSSDFN 432

  Fly   282 THMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGE 346
            .|.:.||..|.:.||.|...|:|.|....|.|.||||:||:|..|.:.|:.||.|.:|.|.||||
Human   433 IHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGKGFSRSSDLNVHCRIHTGE 497

  Fly   347 KPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVELQSHVEHCAKCPVDGDK 411
            ||::|:.|..  ||||.:.|:.| :::|..:|||.|..|...|.:..:||:| :.|.    .|:|
Human   498 KPYKCERCGK--AFSQFSSLQVH-QRVHTGEKPYQCAECGKGFSVGSQLQAH-QRCH----TGEK 554

  Fly   412 P 412
            |
Human   555 P 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 52/215 (24%)
C2H2 Zn finger 95..115 CDD:275368 6/76 (8%)
zf-H2C2_2 107..132 CDD:290200 10/81 (12%)
C2H2 Zn finger 123..144 CDD:275368 6/21 (29%)
C2H2 Zn finger 152..172 CDD:275368 9/20 (45%)
zf-H2C2_2 165..189 CDD:290200 13/24 (54%)
C2H2 Zn finger 180..200 CDD:275368 6/20 (30%)
COG5048 <192..369 CDD:227381 60/177 (34%)
C2H2 Zn finger 210..230 CDD:275370 6/20 (30%)
C2H2 Zn finger 238..260 CDD:275371 6/22 (27%)
C2H2 Zn finger 267..287 CDD:275368 5/20 (25%)
C2H2 Zn finger 295..315 CDD:275368 8/20 (40%)
zf-H2C2_2 309..332 CDD:290200 11/23 (48%)
C2H2 Zn finger 323..343 CDD:275368 8/20 (40%)
C2H2 Zn finger 351..374 CDD:275368 8/23 (35%)
C2H2 Zn finger 382..399 CDD:275368 6/17 (35%)
ZNF45NP_003416.1 KRAB 8..67 CDD:214630
KRAB 8..47 CDD:279668
C2H2 Zn finger 166..186 CDD:275368 3/20 (15%)
COG5048 190..602 CDD:227381 113/379 (30%)
C2H2 Zn finger 194..214 CDD:275368 6/20 (30%)
C2H2 Zn finger 251..270 CDD:275368 0/19 (0%)
C2H2 Zn finger 278..298 CDD:275368 6/21 (29%)
zf-H2C2_2 290..314 CDD:290200 9/25 (36%)
C2H2 Zn finger 306..326 CDD:275368 9/20 (45%)
zf-H2C2_2 319..343 CDD:290200 13/24 (54%)
C2H2 Zn finger 334..354 CDD:275368 6/20 (30%)
zf-H2C2_2 346..370 CDD:290200 7/26 (27%)
C2H2 Zn finger 362..382 CDD:275368 6/20 (30%)
zf-H2C2_2 374..397 CDD:290200 5/23 (22%)
C2H2 Zn finger 390..410 CDD:275368 5/21 (24%)
zf-H2C2_2 402..427 CDD:290200 6/26 (23%)
C2H2 Zn finger 418..438 CDD:275368 5/20 (25%)
zf-H2C2_2 430..455 CDD:290200 9/25 (36%)
C2H2 Zn finger 446..466 CDD:275368 8/20 (40%)
zf-H2C2_2 458..483 CDD:290200 11/25 (44%)
C2H2 Zn finger 474..494 CDD:275368 8/20 (40%)
zf-H2C2_2 486..511 CDD:290200 14/27 (52%)
C2H2 Zn finger 502..522 CDD:275368 8/23 (35%)
zf-H2C2_2 514..538 CDD:290200 9/25 (36%)
C2H2 Zn finger 530..550 CDD:275368 7/21 (33%)
zf-H2C2_2 543..565 CDD:290200 7/19 (37%)
C2H2 Zn finger 558..578 CDD:275368
zf-H2C2_2 570..595 CDD:290200
zf-C2H2 584..606 CDD:278523
C2H2 Zn finger 586..606 CDD:275368
zf-H2C2_2 598..622 CDD:290200
C2H2 Zn finger 614..634 CDD:275368
zf-H2C2_2 626..650 CDD:290200
C2H2 Zn finger 642..662 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.