DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11247 and ZFP37

Sequence 1:NP_001097659.1 Gene:CG11247 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001269444.1 Gene:ZFP37 HGNCID:12863 Length:645 Species:Homo sapiens

Alignment Length:393 Identity:128/394 (32%)
Similarity:177/394 (45%) Gaps:43/394 (11%)


  Fly    42 KRRKSSLASLRDAC-----------------VDEEEDDGGEQDSKDDDYVQPQLKKSARKGEP-V 88
            |..|.|..|..|.|                 :.:::...||:..|     .|.|..|.:..:| .
Human   244 KHEKLSSHSSSDKCNKTGKKHDKLCCHSSSHIKQDKIQTGEKHEK-----SPSLSSSTKHEKPQA 303

  Fly    89 KRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCS 153
            ..|.:.|:||.|....|..|..|..:|:.|:|::|.:||.::.|..:|..|..| |...|.:.|.
Human   304 CVKPYECNQCGKVLSHKQGLIDHQRVHTGEKPYECNECGIAFSQKSHLVVHQRT-HTGEKPYECI 367

  Fly   154 QCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFS 218
            ||.|:...|..|..|:|:|:|||||.|..|.|.|.....|.||:.||  |..:.:.|.:|..||.
Human   368 QCGKAHGHKHALTDHLRIHTGEKPYECAECGKTFRHSSNLIQHVRSH--TGEKPYECKECGKSFR 430

  Fly   219 TNANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATH 283
            .|::|..|:..|...:.:.|:.|...|....:|..|: :.|.....|||..|.|.......|..|
Human   431 YNSSLTEHVRTHTGEIPYECNECGKAFKYSSSLTKHM-RIHTGEKPFECNECGKAFSKKSHLIIH 494

  Fly   284 MQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKP 348
            .:.||..|.:.|..|...|...|....|||.||||.|::|..|.:.|.....|..|.|.||||||
Human   495 QRTHTKEKPYKCNECGKAFGHSSSLTYHMRTHTGESPFECNQCGKGFKQIEGLTQHQRVHTGEKP 559

  Fly   349 FRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVEL----QSHVEHCAKCPVDG 409
            :.|..|..  ||||.:||..| ::.|..:|||.|..|...|..|.:|    :||.         |
Human   560 YECNECGK--AFSQKSHLIVH-QRTHTGEKPYECNECEKAFNAKSQLVIHQRSHT---------G 612

  Fly   410 DKP 412
            :||
Human   613 EKP 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 55/159 (35%)
C2H2 Zn finger 95..115 CDD:275368 7/20 (35%)
zf-H2C2_2 107..132 CDD:290200 8/25 (32%)
C2H2 Zn finger 123..144 CDD:275368 7/21 (33%)
C2H2 Zn finger 152..172 CDD:275368 8/20 (40%)
zf-H2C2_2 165..189 CDD:290200 13/24 (54%)
C2H2 Zn finger 180..200 CDD:275368 8/20 (40%)
COG5048 <192..369 CDD:227381 62/177 (35%)
C2H2 Zn finger 210..230 CDD:275370 7/20 (35%)
C2H2 Zn finger 238..260 CDD:275371 6/22 (27%)
C2H2 Zn finger 267..287 CDD:275368 5/20 (25%)
C2H2 Zn finger 295..315 CDD:275368 7/20 (35%)
zf-H2C2_2 309..332 CDD:290200 11/23 (48%)
C2H2 Zn finger 323..343 CDD:275368 6/20 (30%)
C2H2 Zn finger 351..374 CDD:275368 9/23 (39%)
C2H2 Zn finger 382..399 CDD:275368 7/21 (33%)
ZFP37NP_001269444.1 KRAB 47..106 CDD:214630
KRAB 47..86 CDD:279668
COG5048 288..>633 CDD:227381 120/350 (34%)
C2H2 Zn finger 310..330 CDD:275368 7/20 (35%)
C2H2 Zn finger 338..358 CDD:275368 7/21 (33%)
zf-H2C2_2 350..372 CDD:290200 9/23 (39%)
C2H2 Zn finger 366..386 CDD:275368 8/20 (40%)
zf-H2C2_2 378..403 CDD:290200 13/25 (52%)
C2H2 Zn finger 394..414 CDD:275368 8/20 (40%)
zf-H2C2_2 406..431 CDD:290200 10/27 (37%)
C2H2 Zn finger 422..442 CDD:275368 7/20 (35%)
zf-H2C2_2 434..459 CDD:290200 6/25 (24%)
zf-C2H2 448..470 CDD:278523 5/23 (22%)
C2H2 Zn finger 450..470 CDD:275368 5/21 (24%)
zf-H2C2_2 462..486 CDD:290200 8/25 (32%)
C2H2 Zn finger 478..498 CDD:275368 5/20 (25%)
zf-H2C2_2 490..513 CDD:290200 7/23 (30%)
C2H2 Zn finger 506..526 CDD:275368 7/20 (35%)
zf-H2C2_2 518..543 CDD:290200 11/25 (44%)
C2H2 Zn finger 534..554 CDD:275368 6/20 (30%)
zf-H2C2_2 547..571 CDD:290200 14/26 (54%)
C2H2 Zn finger 562..582 CDD:275368 9/23 (39%)
zf-H2C2_2 574..598 CDD:290200 10/25 (40%)
C2H2 Zn finger 590..610 CDD:275368 6/20 (30%)
zf-H2C2_2 603..627 CDD:290200 6/23 (26%)
C2H2 Zn finger 618..638 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.