DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11247 and ZNF253

Sequence 1:NP_001097659.1 Gene:CG11247 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_066385.2 Gene:ZNF253 HGNCID:13497 Length:499 Species:Homo sapiens

Alignment Length:313 Identity:106/314 (34%)
Similarity:157/314 (50%) Gaps:8/314 (3%)


  Fly    95 CSQCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSF 159
            |..|.|.|...:.|..|..||:.|:|::|::|||::.|:.||..| ...|...|.:.|.:|.|:|
Human   174 CIICGKAFKRSSTLTTHKKIHTGEKPYRCEECGKAFNQSANLTTH-KRIHTGEKPYRCEECGKAF 237

  Fly   160 ALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLR 224
            .....|..|.::|:|||||.|:.|.|.|.|...|..|.:.|  |..:.:.|.:|..:|...:::.
Human   238 KQSSNLTTHKKIHTGEKPYKCEECGKAFNRSTDLTTHKIVH--TGEKPYKCEECGKAFKHPSHVT 300

  Fly   225 VHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTA 289
            .|.:.|.:|..:.|..|...|.:...|..| .:.|.....::||.|.|.......|.||...||.
Human   301 THKKIHTRGKPYNCEECGKSFKHCSNLTIH-KRIHTGEKPYKCEECGKAFHLSSHLTTHKILHTG 364

  Fly   290 VKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLC 354
            .|.:.|..|...|...:....|.::||||:||:|..|.:||...|:|..|.|.||||||::|:.|
Human   365 EKPYRCRECGKAFNHSTTLFSHEKIHTGEKPYKCDECGKTFTWPSILSKHKRTHTGEKPYKCEEC 429

  Fly   355 EDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVELQSHVE-HCAKCP 406
            ..  :|:..:.|..| |:||..:|||.||.|...|....:|..|.: |..:.|
Human   430 GK--SFTASSTLTTH-KRIHTGEKPYKCEECGKAFNWSSDLNKHKKIHIERKP 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 50/152 (33%)
C2H2 Zn finger 95..115 CDD:275368 7/20 (35%)
zf-H2C2_2 107..132 CDD:290200 10/25 (40%)
C2H2 Zn finger 123..144 CDD:275368 8/21 (38%)
C2H2 Zn finger 152..172 CDD:275368 6/20 (30%)
zf-H2C2_2 165..189 CDD:290200 12/24 (50%)
C2H2 Zn finger 180..200 CDD:275368 7/20 (35%)
COG5048 <192..369 CDD:227381 54/177 (31%)
C2H2 Zn finger 210..230 CDD:275370 4/20 (20%)
C2H2 Zn finger 238..260 CDD:275371 6/22 (27%)
C2H2 Zn finger 267..287 CDD:275368 7/20 (35%)
C2H2 Zn finger 295..315 CDD:275368 4/20 (20%)
zf-H2C2_2 309..332 CDD:290200 11/23 (48%)
C2H2 Zn finger 323..343 CDD:275368 8/20 (40%)
C2H2 Zn finger 351..374 CDD:275368 7/23 (30%)
C2H2 Zn finger 382..399 CDD:275368 6/17 (35%)
ZNF253NP_066385.2 KRAB 4..62 CDD:214630
KRAB 6..43 CDD:279668
C2H2 Zn finger 146..166 CDD:275368
COG5048 170..>497 CDD:227381 106/314 (34%)
C2H2 Zn finger 174..194 CDD:275368 7/20 (35%)
zf-H2C2_2 187..211 CDD:290200 10/24 (42%)
C2H2 Zn finger 202..222 CDD:275368 8/21 (38%)
zf-H2C2_2 214..239 CDD:290200 9/26 (35%)
C2H2 Zn finger 230..250 CDD:275368 6/20 (30%)
zf-H2C2_2 242..267 CDD:290200 12/25 (48%)
C2H2 Zn finger 258..278 CDD:275368 7/20 (35%)
zf-H2C2_2 270..295 CDD:290200 7/27 (26%)
C2H2 Zn finger 286..306 CDD:275368 4/20 (20%)
C2H2 Zn finger 314..334 CDD:275368 5/21 (24%)
zf-H2C2_2 326..350 CDD:290200 7/25 (28%)
C2H2 Zn finger 342..362 CDD:275368 7/20 (35%)
zf-H2C2_2 354..379 CDD:290200 9/25 (36%)
C2H2 Zn finger 370..390 CDD:275368 4/20 (20%)
zf-H2C2_2 383..406 CDD:290200 11/23 (48%)
C2H2 Zn finger 398..418 CDD:275368 8/20 (40%)
zf-H2C2_2 411..434 CDD:290200 12/25 (48%)
C2H2 Zn finger 426..446 CDD:275368 7/23 (30%)
zf-H2C2_2 439..462 CDD:290200 12/24 (50%)
C2H2 Zn finger 454..474 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.